KEGG   Egretta garzetta (little egret): 104132092
Entry
104132092         CDS       T05152                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104132092 (CACNA1E)
   04020 Calcium signaling pathway
    104132092 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:egz04040]
    104132092 (CACNA1E)
Ion channels [BR:egz04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104132092 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 104132092
NCBI-ProteinID: XP_009643637
LinkDB
Position
Unknown
AA seq 2124 aa
MARFGEAVAGRLGSGDGGSDQNRSRQGPPAPAGGTPGAFKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGHEQRALVA
RLRKPGATLLANRTICTEEVMLAEENKNSGTSALEVLRRATIKRNRTDAMNRDSSDEHCV
DISSVGNPLSHSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACV
AIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIF
EVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLF
IVVFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGV
RSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAK
EVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLYNGAGGGIEDRARMRQSQRRSRHRRAR
MEGKEPSGALGSRSASQEMGLEEASPMEGAQDGDQRGDAASAEALIQGEPEASGEPIRTN
GVPAGDAELAGTVEEGSPPQGAPETPRGKTGSLIEQDCSSLDTSEQALLEASRTVSRSEP
DLSSITPNTEKATESTTIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEEMEKKKRKK
EKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLT
NSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFA
LANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKL
FMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNI
IWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIF
VALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSP
SFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYF
RDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLW
TFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFR
SATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLF
VAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLG
KRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKE
ILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPM
FQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIFQLACMDPAHGQ
FQEHQSLEPEVREFQRVQPSNRGTCLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRR
SFSTIRDKRTNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADPGHRSDGHRSG
GRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQTPNRQGTGSL
SESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAGDASPPAEESEGGSPLLSS
TLEPNASGLTESSSSPAGKQSRQSTPQRYISEPYLSEEPPEGKSSVLIDAFEEEEEEDDL
EPTSGDVLIISSVIPMRKTIVCWH
NT seq 6375 nt   +upstreamnt  +downstreamnt
atggctcgctttggggaggcagtggccggcaggctgggctctggagatgggggctctgac
cagaaccggagccggcaaggaccccctgctcctgcaggagggaccccgggagccttcaag
caaaccaaagcgcagagagcccggactatggctctgtacaaccccatccccgtccggcag
aactgcttcaccgtcaacagatcactcttcctctttggggaagagaacatagtcaggaaa
tacgccaagaagctcatcgactggcctccctttgagtacatgatcctggcgaccatcatt
gccaactgcattgtgctggcccttgagcagcacctccctgaggacgacaagacgcccatg
tcacggagattagagaagacggagccctacttcattgggattttctgctttgaggctggg
attaagatcgtggctctggggtttgttttccacaagggctcatacctgcgcaacggctgg
aacgtcatggatttcatcgtggtcctcagcggcatcctcgccaccgctgggacgcacttc
aacacccacgtggacctgcggacgctgcgggccgtgcgcgtgctcagacctctgaagctt
gtctcgggcattcccagcctgcagattgtgctgaagtccattatgaaggccatggtgcct
ctccttcagattggcttgctgctctttttcgctatcctcatgtttgccatcatcggcctg
gagttttacagcgggaagttgcaccgagcctgctacacaaacaattcaggtgagctagag
gagctggaccccccccatccatgcggggtgcagggttgccccccaggctacgagtgccgg
gagtggattggtcccaacgacgggatcacgcagttcgacaacatcctttttgctgtgttg
accgtcttccagtgcatcaccatggaagggtggaccacagtcctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaaccttgtcctgggagtgctgtcaggccatgagcagcgagccctggtagcc
cgcttgcggaaacctggagccacgctgcttgcaaaccgcaccatctgcaccgaggaagtc
atgctggctgaagagaacaaaaattctgggacctcagccttagaagtgctcaggcgagcc
accatcaaaaggaaccggacggacgccatgaaccgtgactcgagcgacgagcactgcgtc
gatatatcctccgtgggtaaccccttgagccattctggcctcaaaggtgccagggtggac
ggtgcctcctacttacggcacaaggagcgactcctgcgcatctccgttcgccacatggtg
aaatcacaggtcttctactggatcgtcttgagcctggtggctctcaacactgcctgcgtg
gccatcgtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttc
ctgtttcttgggctcttcctcctggagatgtccttaaagatgtacgggatggggccacgc
ctttacttccattcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttt
gaagtggtttgggctatcttcagaccaggaacctcttttgggatcagtgtcctgcgagcc
cttcgtctcctgcgaatatttaaaataaccaagtactgggcatccctgaggaatttggtg
gtctcactgatgagctccatgaagtctattatcagcctgctcttccttctcttcctcttc
attgtagtctttgccctgctgggaatgcagctgtttggaggcaggtttaacttcatcgat
gggacaccatcagccaactttgacactttccccgcggccattatgacagtcttccagatc
ctgacaggcgaggactggaatgaggtgatgtacaacggcatacgctcccagggaggtgtt
cgctcaggcatgtggtcctccatctatttcatcgtcctcaccttgtttggaaactatact
ctgctgaacgtgttcttggctattgcggtggacaacctggccaatgctcaggagctcacc
aaggacgagcaggaggaagaggaggcctttaatcagaagcacgcccttcagaaagccaaa
gaagtcagccccatgtccgccccaaacatgcctgctatcgaaagagacaggcgaaggaga
caccacatgtcgatgtgggagccacgcagcagccacctgtataacggggcaggaggcggc
atcgaggatagggcgaggatgaggcagagccagcggcgcagtcggcaccgcagagcccgg
atggaggggaaggagccatccggtgccctggggagccgctcagccagccaggagatgggt
ctggaggaggccagccccatggagggggcacaggatggggaccagcgtggggacgcagcc
tcagcggaggcgctgatccagggggagccagaagcgagcggagagcccatcaggacaaat
ggggtccctgctggtgatgccgagctggctgggactgttgaggaggggagccccccgcaa
ggagcacccgagaccccccgggggaagacgggcagcctgatagagcaggactgcagcagc
ctggacaccagcgagcaagcgctgctggaggccagccgcaccgtcagccggagcgagcct
gacctctcttccatcacccccaacaccgagaaggccacggagagcaccaccatcatgatc
gatgtccacgactccgctgtggtacagattagcaacaagacagatggagaagccagcccc
ttaaaggaggctgagaccaaagaggacgaggaagagatggagaagaagaagcggaagaag
gagaagagcgagacgggcaaagcgatggtgccacacagctccatgttcatcttcagcacc
accaacccggtgcggcgggcttgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctcctggtgattgccgccagcagcatcgccctcgcggcggaggatcccgtcctcacc
aactctgaccgcaacaaagtcctgaggtactttgactacgtcttcactggtgtcttcacc
ttcgagatggttatcaagatgatcgatcagggcttgatcctgcaggacggctcctacttc
cgagacctctggaacatcctggatttcatcgtggtggtgggagcgctggtggctttcgcc
ttggcgaacgctttggggaccaacaagggccgggatatcaagaccatcaagtctctccgt
gtgctgcgggtcttgaggcccctgaaaaccatcaagagactgcccaagctgaaggccgtc
tttgactgtgtggtgacttcactcaagaatgtcttcaacatcctcattgtctacaaactc
ttcatgttcatctttgctgtcattgctgtccagctcttcaaggggaaattcttctactgc
actgacagctctaaggacacggagaaggactgcatagggaactatgtggaccacgagaag
aacaagatggaagtgaagtgccgggaatggaaacgccatgagtttcactacgacaacatc
atctgggctttgctcaccctgttcacagtctccaccggcgagggttggccccaggtgctg
cagcattcggtggatgtgacggaggaggaccgtggccccagccgcagcaaccgcatggag
atgtccattttttatgtcgtctactttgtggtcttccctttcttctttgtcaacattttt
gtggctctcatcatcattacattccaagagcaaggagacaaaatgatggaggaatgcagt
ctggagaagaacgagagggcctgtattgactttgccatcagtgccaagcccctcacgcgg
tacatgccccagaaccggcacaccttccagtaccgggtctggcactttgtggtctcccca
tccttcgagtacaccatcatggccatgatagcattgaacaccgtggtgctgatgatgaag
tactactctgctccgtacacctatgagctggccctgaagtacctgaacatcgcgttcacc
atggtattctccttggagtgcgtcctcaagatcattgcttttggcttcctgaattatttc
cgggacacctggaacatctttgacttcatcaccgtcattggcagcattacggagatcatc
ctgacggacaccaagctggtgaacaccagcagcttcaacatgagcttcctgaagcttttc
cgggctgctcggctcatcaagctgctgcgccagggttacaccatccgcatcctgctctgg
acgttcgtgcagtccttcaaggccctcccctacgtctgcctcttgatcgccatgcttttc
ttcatctatgcgatcattgggatgcaggtttttggcaatatcaaactagatgaggaaagc
cacattaaccggcacaacaacttccggagcttcctgggctccctcatgctcctcttcagg
agtgccacgggagaggcatggcaggagatcatgctgtcctgcctggaaggcaaaggctgc
gagccagacacaacggcgacgtccgggcagaatgagaacgagcgctgcggcactgacctg
gcctatgtttactttgtctccttcatcttcttctgctctttcctgatgctcaacctgttc
gtggcagtcatcatggacaattttgaatatctgacacgggattcctccatcctgggacct
caccatctagatgagtttgtccggatctgggcagagtatgacagagcagcgtgtggccga
atccattacactgagatgtatgaaatgctgactcttatgtcaccaccgctaggcctcggc
aagagatgtccttccaaagtggcctataagagactggtactgatgaacatgcccgtggcc
gaggacatgacggtccattttacctccaccttgatggctctgatacgcacagccttggac
atcaaaattgccaaaggtggtgcagattggcagcagttagactccgagcttcaaaaggag
atcctgacaatttggcctcacctgtctcagaagatgcttgacctgttggtacccatgcca
aaaacctctgacctgactgttggcaaaatatatgcagccatgatgatcatggattactac
aagcagagcaaagcgaagaagcagcggcagcagctggaggagcagaaaaatgcccccatg
ttccagcgcatggaaccatcctctttgccgcaggaaatcatctcaaacgcaaaggctctg
ccttacctccagcaggacaccctctcgggcctgagcagccggagcgggttcccctcgcta
agcccgctctcgccacaggagatcttccagctggcatgcatggatccggcccatgggcag
ttccaggagcaccagtctctggagccagaggttagggagtttcaaagagtgcagccctct
aaccgtggcacctgccttcccgtggacactcaggaccacgctgtctctgggagggcctcc
tccatgcctcgtctcactgtggatccccaggtggtgacggacaccagctcgatgcggcga
tcgttttccaccatccgggacaagcggaccaacagctcctggctggatgagttctccatg
gagcgcagcagtgacaacacctacaagtcccgccggcgcagctaccactcctcgctccag
ctctccgcccggcgcctcaacgctgacccaggccaccggtccgacgggcatcgctcaggc
ggcagggagcggggccgatccaaagagcgcaagcacttgctgtcccccgatatctcccgc
tgcaactccgaggagaggagtcctcaggcgcacgatgagtcgccagagcggcggcgtgag
tcccggtcacccagcgagggcaggtcgcagacgcccaacaggcagggaacgggctccttg
agcgaaagctccatcccctccatctcggacaccagcaccccccggcgaggccgccgccag
ctcccaccagtgccccccaagccgcgtcccctcctctcctacgcctccatgctgcggcac
gccggagacgcctcgccgcccgccgaggagagcgagggggggtccccgctcctctcctcc
accctggagcccaacgcctctggcctgaccgagtcttccagctccccggcggggaagcag
agccgacagtccaccccgcaacgctacatctcggagccctacctgtctgaggaacctcca
gaaggaaaaagcagcgttcttattgatgcctttgaggaggaggaggaggaggacgacctg
gagcccacctctggagatgttttgatcatttcctccgtgatccctatgaggaagaccatt
gtttgctggcattag

DBGET integrated database retrieval system