KEGG   Egretta garzetta (little egret): 104132232Help
Entry
104132232         CDS       T05152                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04210  Apoptosis
egz04625  C-type lectin receptor signaling pathway
egz04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104132232 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104132232 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104132232 (MAP3K14)
   04672 Intestinal immune network for IgA production
    104132232 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104132232 (MAP3K14)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104132232 (MAP3K14)
Protein kinases [BR:egz01001]
 Serine/threonine kinases: STE group
  Other
   104132232 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104132232
NCBI-ProteinID: XP_009643790
LinkDB All DBs
Position
Unknown
AA seq 930 aa AA seqDB search
MAVMGITCQGAPDPAVKHKKELTATKGLNETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTKKKRHKKRSKLKIQTVAASRRGPRTPEQESCTPIPVQED
ESHQNALYRNDYWVTELNKDLVYDPLPFEKPEKVLSTGKLHSPRSQYKTELHKLISPIQC
LNHVWKRHYQRDSVPQPETLHPDSPLYAMKHNALGTYFHGDLNYQDSEHHLSGLNLEYSF
PKCVNQSMKNSLDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGGGLDPKEQFHEADE
NEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAAKKVQVEHF
RAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLPEDRALSYL
GQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGKCLVTGNYV
PGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKIAKEPPPLR
EIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTSPWKGEYREPRHLS
LNKENNPQMSMSPTVSPVSEAGSDPKLAVKVSCVSPVLPPPSLEQTEEVEGTPWNVCKEL
SETWDPPPLSSTPLPLKSCSHVERAATISEQELQQLEIELFLNSLSQPYSLEEQEQMLSC
LSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQTDGQSFSWNNLLNRSRHTDTPSY
FNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQPVHYDMEVPD
SGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccaaggtgctcctgatccagccgtcaagcacaagaag
gagctcacagctaccaaggggctgaacgagacagttagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccctactttatcagagagatccttt
attgctcatagtaagcgttacagccggtcagacagtctcgatcaaatccctaacaatgtg
gcccatgcaacggaggggaagatggcacctacctgctggagagggaggcatcgcggtaag
acaaaaaagaaacgtcacaagaaaagatccaagctgaaaatacaaacagtggctgctagc
aggcgaggtccgagaactccagaacaggagagctgcacaccaattcctgtccaggaggat
gaatcacaccaaaatgctctttacagaaacgattattgggttacagaacttaacaaggac
ttggtctatgatccactgccatttgagaaacctgagaaagttctgtccacgggcaaactt
cattcaccaaggagccaatacaaaacagaactgcataagttgataagccctattcagtgc
cttaatcatgtttggaaacggcactatcagagggacagtgttccacagcctgaaacgctc
catcctgacagtcctctctatgccatgaaacataatgctctggggacgtacttccatggt
gatctgaactatcaggacagtgagcatcacttatctggcctaaacttagaatatagtttc
cccaaatgtgtcaaccaatccatgaaaaacagtttggataagatttctgtggaagaatac
ttggtagatgccctgaagggcagcgtgagtctcggtgaaccacaaaatttagccagccta
gccaagacgtggcgaggaggtggtctggacccgaaggaacaatttcatgaagcggatgaa
aatgaaggcgtgctacttaatgagaaactaaagccagtggattatgagtaccgagaagag
gttcactggaccaagtgtcatggctctttgggcattggctcttttggagaagtatacaaa
atagaggacaaacagacaggatttcagtgtgctgccaaaaaggtacaagttgaacacttc
cgtgcagaggagttaacgacatgtgctgcaataacaagtcctaaagttgtccccttgtac
ggagctgtgaaggaaggaccttgggtgaccatcttcatgaagctgatggagggtggctca
ctaggtcagctaattaaacagagtggctgcctgccagaggacagagccctcagttatctg
ggccaggcattagagggcttggagtatcttcacgctcaaaacattctccatggagatgtg
aaagcggaaaatgtgctcttgtctgacgatggaagcagggctcttttgtgtgactttggt
cactctgctcaccttcatccagatggcctgggaaagtgcttggtcacagggaactatgtg
cctggcacggagactcatatggctccggaggtggtcatgggaaagcgttgtgactccaaa
gtagatgtctggagcagttgctgtatgatgctgcacatgcttaacgggtgccacccttgg
acccagtattacaatcacccactctgtttaaagatcgctaaagagccacctcctctgagg
gaaattccaccttcctgcaaccctctcactgctgagattattaaaatgggtctggagaaa
gagcctgttcagagagcgtctgcttctgaactgaaaactaagaccagtgtcgcacttgaa
gaagtgggaggtgtgacaagcccctggaaaggcgagtacagagagcctagacatttgtct
ttgaacaaggaaaacaatccacagatgtccatgtctcccacagtgagcccagtttctgag
gctggttctgacccaaaattggcagtcaaagtttcttgtgtgagcccagtcctaccgcca
ccatctctggagcaaacagaggaggtcgaaggaaccccttggaacgtgtgcaaggagtta
tcggaaacctgggatcctccacctctttcctcgactcctctgcccttgaagagctgcagc
catgtggagagagcagcaaccatttcagagcaggagcttcagcagctggaaatagaactg
tttttgaacagcctttcacagccttactcgctggaagagcaagaacaaatgctttcgtgt
ctcagcatcgacagcccatttgtgtcagacgccagcgagaagaactccatgaaggcttct
catagcttgagggacactatgagctctgggattcattcctggaacagccagacagatgga
caaagcttcagttggaacaacctgttgaatcgcagtcggcacacagacactcccagctat
ttcaacggagtgaaaatccagatccagttgctaagtggagaaaatttacacatcagggat
ttccacaggacaaaggtgggagatattgccactgggataagcagccagataccagtccct
gctttcagtctggttactaaagaaggccagccagttcactacgacatggaggtccccgac
tccggtattgagctgcagtgcacccttgcccctgactgcagtgtcagctggacatggcga
gtcaaacacggtcaactggagaacaggccatga

DBGET integrated database retrieval system