KEGG   Egretta garzetta (little egret): 104132445Help
Entry
104132445         CDS       T05152                                 

Gene name
SUV420H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104132445 (SUV420H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egz03036]
    104132445 (SUV420H1)
Enzymes [BR:egz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104132445 (SUV420H1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104132445 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 104132445
NCBI-ProteinID: XP_009644018
LinkDB All DBs
Position
Unknown
AA seq 860 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHAQNQTKLQHAGKENPKTGKNGVERRSSRCMCMFMR
LRFEGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEV
IERFKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPC
NRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNC
AQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCE
CYTCERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNT
DADTTQEKANATNRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRL
KKPAKPLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVK
VAVSSGCLTRHAAREHKLNSVKGAHEHGDIPPCTYITRRSMRTRMNLKETSDIKLEPNML
DSYKNNLTGTQSDTLEQQSHVINENDVAHGPSHKGEIRCQKNDAGMSKKKSRQGKLVKPS
AKIEETDTTHNTPVKDEVPDLISSHSELGERNNVVDTPVGYKDCIPGSGGCSVVTSDNFK
AKDSFRTAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMSSSKIS
IKLSKDHEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREEENRGTYPEDLHENGMCCSE
TLSLLESRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKD
SIDIDISSRRREDQSLRLNA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtggtgaatggcaggagaagtggaagcaag
tcgtctaatgaccatgcgcagaatcagaccaaattacagcacgcaggaaaggagaatccg
aagacaggcaaaaatggagttgagagaagatcgagcagatgtatgtgcatgtttatgcgg
cttagatttgagggtcaaagtcgttatgtgccttcctctggaatgtctgccaaggaactg
tgtgaaaacgatgacctagcaactagtttggttcttgatccctatttaggttttcagaca
cacaaaatgaatactagatttcgacctattaaaggaaggcaagaagaactaaaagaggtg
attgaacgttttaagaaagatgagcacttagaaaaagccttcaagtccttgacgtcaggt
gactgggcccggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaa
catgtatttatttatttacgaatgtttgcaactgacagtgggtttgagatactgccttgt
aatcggtattcttctgagcaaaatggagccaaaatcgttgcaacgaaagaatggaaacga
aatgataaaatagaattacttgtgggctgtattgctgaactatcagaaatggaagaaaac
atgctgctgagacatggggaaaatgacttcagtgtcatgtattccacacggaaaaactgt
gcacaactgtggcttggtcctgctgcatttatcaatcatgattgcagacctaactgtaag
tttgtatcaacgggcagagatacagcatgtgtgaaagctctgagagatattgaacctgga
gaagaaatttcttgttactatggagatggattttttggagaaaataatgaatactgcgaa
tgttacacctgtgaaagacgtggaactggtgcttttaaatcaagagtgggattgccagca
cctactcctgtgattaatagtaaatatggactgagggaaacagataaacgattgaacaga
cttaaaaagttgggtgacagcagcaaaaattcagacagccagtccgtcagctctaacact
gatgcagataccactcaggaaaaagctaatgcaactaacagaaaatcatcgattggcgta
aaaaagaacagcaaaaatagaacattaacaagacagtctatatcaagaattccagcatca
tcaaattctacctcatctaaactaactcatataaataattccagggtaccaaagagactg
aaaaagcctgcaaagcctttactttcaaagataaagttgagaaatcagtgcaaaaggcca
gagcaaaagaatgcttctagaaagctcgaaatgggaaatttagttctcaaagagcctaaa
gtagttttgtataaaaacttgcccattaaaaaggataaagaattggagggaccagtcaaa
gttgcagtctctagtggatgcttaacaaggcatgcagcaagagaacataaactgaattct
gtgaaaggtgctcacgagcatggtgatataccaccctgcacatacataacaaggaggtca
atgagaacaaggatgaatttgaaggagacctctgacataaagcttgaaccaaatatgttg
gatagctataagaataatttgaccggaacgcaatcggacactttagagcagcagtctcat
gtgataaacgaaaatgatgtggctcatggaccatcacataaaggggagattaggtgccag
aaaaacgatgctggcatgtcaaaaaagaaatctcgacaaggaaaacttgtgaaaccatct
gcaaaaatagaagaaactgatactacgcacaatacacctgtgaaagatgaagtaccagat
ttgattagttctcattcagaactcggagagaggaataatgtggtggacacgcctgttggc
tataaagactgtatccctggatctggtggctgctctgttgtaacatctgacaattttaaa
gcaaaagacagctttagaactgcaaaaagtaaaaagaaaagacgaatcacgaggtatgat
gcacaacttatccttgaaaatagctctgggatccctaaactgactcttcgtagacgccat
gatagcagtagcaaggcaaatgaccaagaaagtgatggaatgagttcttcgaaaataagc
atcaaattaagtaaagaccatgaaaaagataataatttatatgtagcaaagctaaataat
gggtttaactcaggatcaggtaatagttcaacaaaattaaaaatacagctgaaacgagag
gaagaaaacagagggacgtaccctgaggaccttcatgaaaatggtatgtgttgtagtgaa
actctctcccttttggagtcaagaatggaagtagatgattatggtcactatgaagaggaa
acagcagatgaatcttcatcagaagaggatgatgaagaggaagatgactatgatgacgaa
tttgatgactttattcctcttcctccagcgaagagattaaggcttattgttggcaaggat
tcaatagatattgatatttcttccaggaggagagaagatcagtctttaaggctcaatgca
taa

DBGET integrated database retrieval system