KEGG   Egretta garzetta (little egret): 104132910
Entry
104132910         CDS       T05152                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04120  Ubiquitin mediated proteolysis
egz04144  Endocytosis
egz04218  Cellular senescence
egz04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104132910 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104132910 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104132910 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    104132910 (MDM2)
   04115 p53 signaling pathway
    104132910 (MDM2)
   04218 Cellular senescence
    104132910 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104132910 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egz04131]
    104132910 (MDM2)
   04121 Ubiquitin system [BR:egz04121]
    104132910 (MDM2)
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104132910 (MDM2)
Membrane trafficking [BR:egz04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104132910 (MDM2)
Ubiquitin system [BR:egz04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    104132910 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 104132910
NCBI-ProteinID: XP_009644546
LinkDB
Position
Unknown
AA seq 484 aa
MCNTKMSSLTDGSSVTASEQEALVKPKPLLLKLLKLAGAEKDTFTMKEVIFYLGQYIMSK
QLYDEKQQHIVHCANDLLGDLFGVTSFSVKEHRRLYSMISRNLIAINQQDSTLADTPEDD
ARFQLEEENVLKESMQELEEKQTSSNVTSRPTTSSRRRTHSESEENSSDDLHSDRRKRHK
SDSISLTFDESLSWCVVSGLCRERSNSSDSTDSLSIPDLDASSLSENSDWFDHSSVSDQF
SVEFEVESIYSEDYSHNEEGLELTDEDDEVYQLTIYQDEDSDADSFDEDPEISLADYWKC
PECSEMNPPLPRHCHRCWALREDWLPDEKSNKLVKSKLESSFPLESEEGFDVPDCKKVKT
TEDKEPAVEENEDKAVQISESQESEDYSQPSTSSSMFCSSQEDYKEPEKREAQDKEESME
SSLPVTSIEPCVICQSRPKNGCIVHGKTGHLMSCFTCARKLKKRNKPCPVCRQPIQMIVL
TYFS
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtgcaataccaagatgtcctcccttacggatggctcctctgtcaccgcgtcggagcaa
gaggcgctggttaaaccaaagccactgttgttgaagttgttaaagttagctggtgcagaa
aaggacacttttactatgaaggaggtaatattctatcttggacaatatattatgtctaaa
caattatatgatgaaaaacagcaacatattgtacactgtgcaaatgatctcctgggggat
ttatttggagtaacaagcttttcagttaaagaacacaggagactatattcaatgatttcc
agaaatctgatagcaatcaatcaacaagactctacgcttgctgacacacctgaggatgat
gccagatttcagcttgaagaagaaaatgttctaaaggaatctatgcaagagttagaagag
aagcagacttcatcaaacgtgacttcccgaccaactacatcatctaggaggagaacacac
agtgaatctgaagaaaattcttcagatgatctgcatagtgacagaagaaaacgacacaag
tcagacagcatttcgttgacgtttgatgaaagtctctcatggtgtgtagtcagtggtctg
tgccgtgaaagaagcaatagcagcgattcaacagattctctttccattcctgatcttgat
gccagttcattaagcgaaaactccgattggtttgaccacagttctgtttcagaccagttc
agtgtagagtttgaagttgagtctatttattcagaagattatagccataatgaagaagga
ctggagcttacagatgaagatgatgaggtatatcagctgactatttatcaggatgaagac
agtgatgctgattcatttgatgaagatccagagatttctctagctgattactggaagtgt
cctgaatgtagcgaaatgaaccctccgctgccacgacattgccacagatgctgggccctt
cgcgaggactggcttccggatgagaagagcaataaactggtaaagagcaaattagaaagt
tccttccccctagagtctgaagaaggttttgatgttcctgactgcaagaaagttaaaacg
actgaggataaagaaccagctgtagaggagaatgaggataaagcggtacagatttccgag
tcccaggaaagtgaagattattcgcagccatcgacatcgagcagcatgttctgcagcagt
caggaggactacaaggaacctgagaagagagaagcgcaagacaaagaggaaagcatggaa
tccagcctgcctgttaccagcatagagccctgcgtcatttgccagagcagacctaaaaat
ggttgcatagtacatggcaaaacgggacacctcatgtcgtgttttacgtgtgcaagaaaa
cttaagaagaggaacaaaccctgcccggtgtgcagacagcccatacaaatgattgtacta
acttattttagctag

DBGET integrated database retrieval system