KEGG   Egretta garzetta (little egret): 104133127Help
Entry
104133127         CDS       T05152                                 

Gene name
H6PD
Definition
(RefSeq) LOW QUALITY PROTEIN: GDH/6PGL endoplasmic bifunctional protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00030  Pentose phosphate pathway
egz01100  Metabolic pathways
egz01200  Carbon metabolism
Module
egz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
egz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    104133127 (H6PD)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     104133127 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     104133127 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N bMG1
Motif
Other DBs
NCBI-GeneID: 104133127
NCBI-ProteinID: XP_009644793
LinkDB All DBs
Position
Unknown
AA seq 745 aa AA seqDB search
MLRGVLCTVLLMGALPSLTEASQGHISVVLLGATGDLAKKYLWQGLFQLYIDQVSSGHSF
TFHGAALTALEPGQRLMFDVLKKLACPSDESPNRCAVLKDQFLKLSQYHQLKTAENYTVL
NREIETLLRQEGLKEAGRIFYFSVPPFAYTEIARHINSSCRPPPGAWLRVVLEKPFGHDL
ESAQQLAAELTSFFREEEMYRVDHYLGKQAVAHILPFRDQKKETVDAKGRTSFYEQYGVI
RDVLQNHLTEALMFLTMELPANVSNAEEVLQCKLQGFQSLRGLEKNSAVLGQYQAYASQV
QEELQKAQDYISTTPTFAGVLIHSDNLRWEGVPFLLTSGKALDERVGYVRVLFKNRAYCT
QTETLRDTGHSQCKAKQIIFYIGHGALKTPAVLVSRNLFRPVMPEGSWREAVGQSDLHIF
GQPLSDYYVYSPVKERDAYSVLISNIYHGRKDFFITTENLLASWRFWTPLLDSISHQPLR
LYPGGVENQRLLDFEMVSGEVAFTLQSPLVSAWSEDLISQLASDIEKTASRTVARSGQFH
LALSGGSSPIVLFRRLARHHYAFPWKHTHIWMVDERCVPLTDIESNFFSLHNHLLQSVRV
PYFNVHPMPVHLNQRLCVEEDRGTELYAKEITALVANASFDLVLLGVGADGHTASLFPQS
ENGLEGAQTVVLTESPVKPHQRMSFSLHLINKARQVFVLVLGKGKHDITTLVSRVGHEPR
KWPISGVSPSSGQLVWYVDYEALLG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaggagtcctgtgtaccgtgttgttgatgggagccctgccatcgctgactgaa
gcgtcccagggccacatctcagtggtcttgctgggagccacaggtgatttggccaagaag
tatttgtggcagggtctattccaactctacattgaccaagtgagcagtggccacagcttc
acgttccatggggctgcactgacagctctggagccagggcagaggctgatgtttgatgtg
ctgaagaagctggcctgtccctcggatgaatctcctaacagatgtgctgtgctcaaggac
caatttctgaagctgagccaataccaccagctgaagactgccgaaaactacactgtgctg
aacagagagattgagacactgcttcgccaggaggggctgaaggaggctggaaggatcttc
tacttctcggtaccaccatttgcctacacagagattgcccgccacatcaacagcagctgc
agaccgcctccaggagcctggttgcgtgtagtgctggagaaaccttttggccatgacctg
gagtcagcccagcagctggctgcagagctgaccagcttcttcagggaagaggagatgtac
cgggtggaccactaccttggcaaacaggctgtagcccatatcctgccttttcgagatcag
aagaaagagactgtggatgctaaaggccgcaccagcttctacgagcagtatggagtcatc
cgggacgtgctgcagaaccacctcacagaggccctgatgttcttgaccatggagctccca
gccaatgtgagcaatgctgaagaggttttgcaatgcaagctacagggcttccagtccttg
aggggcctggagaaaaacagtgctgtgctgggtcagtatcaggcatatgccagccaagta
caggaggaactgcagaaggcacaagactacatcagcacaacaccaacctttgcaggtgtg
ctgattcacagtgacaacctgcgttgggaaggggtccctttcctcctcacttctgggaaa
gctctggatgaacgggtaggttacgtccgtgttctcttcaagaaccgagcctactgcact
cagactgagactctgagggatacagggcacagccagtgtaaagccaagcagatcatcttc
tacattgggcacggcgcactcaaaacccctgcggtacttgtgagcaggaaccttttcagg
cccgtcatgccagaaggcagttggagagaagcagtgggtcagtcagacctgcacattttt
ggacaaccattgtctgattactatgtgtacagccctgtgaaagagagagatgcgtattct
gtcctcatctccaacatctaccatggcaggaaggacttcttcattaccaccgagaacctg
ctggcctcctggagattctggacaccactgctagacagcatttcccaccaacccctgcgc
ctctaccctgggggtgtggagaaccagcgcctcttagactttgaaatggtcagtggggaa
gtggcattcacactgcaaagtcccctggtctcagcatggtctgaggacctgatttcccag
ctggcttctgacattgagaagacagcaagcaggactgtggcacgctctgggcagttccac
ttggccctctcaggtggctcaagcccgatcgtcctgttccggcggctggcaagacaccat
tatgccttcccatggaagcacacccacatctggatggtagatgaacgctgtgtccctctc
actgacatagagtccaacttcttcagcttgcacaaccacctcctccagagtgtcagggtg
ccctacttcaatgtccaccccatgcctgtgcacctgaaccagcggctctgtgtggaagaa
gacagaggcacagagctgtatgccaaggagatcacagccctggtggccaatgccagcttt
gacctggtgctgctgggggtgggcgctgatgggcacactgcctcgctcttcccccagtct
gaaaatggcttggaaggggctcagactgtggtgctgactgaaagccctgtcaaacctcac
caaaggatgagctttagcctacacctcatcaacaaggccaggcaggtgtttgtcctggtt
ttggggaagggtaagcatgacatcaccaccctggtcagcagagtgggccatgagccaagg
aaatggcctatctcaggtgtcagccccagctccggccagctggtgtggtatgtggattat
gaagctctgcttgggtga

DBGET integrated database retrieval system