KEGG   Egretta garzetta (little egret): 104133181Help
Entry
104133181         CDS       T05152                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00020  Citrate cycle (TCA cycle)
egz00190  Oxidative phosphorylation
egz01100  Metabolic pathways
egz01200  Carbon metabolism
Module
egz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
egz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
egz_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104133181 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104133181 (SDHB)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104133181 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 zf_C2H2_13 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 104133181
NCBI-ProteinID: XP_009644846
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MAAAVVGVSLRRSVPARLPRAGPPPMCRGAQTAAAAAPRIKKFAIYRWDPDKPGDKPHMQ
TYEVDLNKCGPMVLDALIKIKNELDSTLTFRICGSCAMNIAGGNTLACIKRIDPDLNKIT
KIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYE
CILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHT
IMNCTRTCPKGLNPGKAIAEIKKMMATYKEKAAAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtgggagtctccttgaggcgcagcgtccccgcacggctcccgcgg
gccggccccccgcccatgtgtcggggagcacagacagcagctgcggcggcgccccgtatc
aagaagtttgccatctacagatgggatcctgataagcctggggacaagccccacatgcag
acgtatgaagtggatttgaataaatgtgggcctatggtgctcgatgctctgatcaagatt
aaaaatgagttggactccactctgaccttccgcatctgtggctcttgtgctatgaacatt
gctggtgggaacacgctggcctgtatcaaaagaattgaccctgatctcaacaagatcact
aaaatctaccctctcccccacatgtatgtggtgaaggaccttgttccagacttgagtaac
ttctatgcacagtacaaatccatcgagccttacctgaagaagaaggatgagtcgaaacag
ggcaaggagcagtatctgcagtccatagaagaccgtcagaaactggatggactctacgag
tgcatcctgtgcgcctgctgcagcaccagctgtcccagttactggtggaatggggacaag
tacttgggccctgcagtactgatgcaggcctatcgctggatgattgactccagagatgac
tacacagaggaacgcctggcacagcttcaagacccgttttctctctaccgttgtcacact
atcatgaattgcacaaggacttgccctaagggtctgaaccccggcaaagcaattgctgag
atcaagaagatgatggcaacttacaaagagaaggcggccgctgcgtaa

DBGET integrated database retrieval system