KEGG   Egretta garzetta (little egret): 104133269Help
Entry
104133269         CDS       T05152                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00350  Tyrosine metabolism
egz01100  Metabolic pathways
Module
egz_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104133269 (GSTZ1)
Enzymes [BR:egz01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104133269 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 104133269
NCBI-ProteinID: XP_009644945
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MASEKPILYGYFRSSCSWRVRIALALKGISYDLVPVSLLNDGGQQFSAEFKALNPMQQVP
VLKIDGITLSQSLAIIQYLEDTHPNPRLLPQDPKKRAQVRMIADHIASGIQPLQNLKVLK
QMGEKKMEWAQTCIASGFQALEQILQHTAGRYCVGDEVSMADLCLVPQVSNAERFKVEMG
PYPTIIRINKALLDLEAFKVSHPSRQPDTPAELRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaaaagccgatactttatggctatttccggagttcctgctcttggagagtg
agaatcgcactggctctgaaagggatttcctatgacctggtgccagtgagcctcctgaac
gacggggggcagcagttttctgctgaattcaaggcattgaatccaatgcagcaagtccca
gtcttgaaaattgatggcatcaccctttctcagtcgctagctataattcagtacctagaa
gatacccatcctaaccccaggctcctgccccaagatccaaagaagagagcccaagtcaga
atgatcgccgatcatattgcctccggcattcagccactccagaacctgaaagtcctgaaa
caaatgggggaaaagaaaatggaatgggctcagacctgcattgcatctggctttcaagca
ctggagcagattctgcagcacactgctgggcgctactgtgtgggggatgaagtgtccatg
gctgatctgtgcttggtgcctcaagtttccaatgctgaaagattcaaagtggaaatgggt
ccatatcccacaataatcagaattaacaaagctctcctggatttagaggcattcaaagta
agccacccatcccggcagccagacactcctgcagagctgcgagcttga

DBGET integrated database retrieval system