KEGG   Egretta garzetta (little egret): 104133279
Entry
104133279         CDS       T05152                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04060  Cytokine-cytokine receptor interaction
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104133279 (TGFB3)
   04350 TGF-beta signaling pathway
    104133279 (TGFB3)
   04068 FoxO signaling pathway
    104133279 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104133279 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104133279 (TGFB3)
   04218 Cellular senescence
    104133279 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:egz04052]
    104133279 (TGFB3)
Cytokines and growth factors [BR:egz04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104133279 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 104133279
NCBI-ProteinID: XP_009644961
LinkDB
Position
Unknown
AA seq 412 aa
MKMYVQRALVLLSLLSFATVSLSLSSCTTLDLDHIKKKRVEAIRGQILSKLRLTSPPETV
GPAHVPYQILALYNSTRELLEEMEEEKEESCSQDNTESEYYAKEIHKFDMIQSLPEHNEL
GICPKGVTSNVFRFNVSSAEKNSTNLFRAEFRVLRVPNLSSKRSEQRIELFQILQPDEHI
AKQRYLSGRNVQTRGSPEWLSFDVTETVREWLLHRESNLGLEISIHCPCHTFQPNGDILE
NLHEVLEIKFKGIDSEDDYGRGDLGRLKKQKDLHNPHLILMMLPPHRLESPALGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgtacgtgcaaagggctctggtgctgctctccctgctgagcttcgccaccgtg
agcctctcgctgtcctcctgcaccaccttggacctggaccacatcaagaagaagagggtg
gaagccatccgggggcagatcctgagcaagctgcggctcaccagccccccggagaccgtg
gggccggcccatgtgccctaccagatcctggccctctataacagcacccgggagctgctg
gaggagatggaggaggagaaggaggagagctgctctcaggacaacaccgagtccgagtac
tatgccaaagagatccataaatttgacatgatccagagcctccccgagcacaatgagttg
ggcatttgtccaaaaggtgtcacctccaatgtgttccgctttaacgtgtcctcggcagag
aagaacagcaccaacttgttccgggctgagtttcgggtgctgcgtgtgcccaacctgagc
tccaaacgcagcgagcagcgcattgagctcttccagatccttcagccggatgagcacata
gcaaagcagcgctacctcagtggcaggaatgtgcagacacgggggtcccctgagtggctg
tcctttgatgtcaccgagactgtgcgtgagtggcttctgcacagagagtccaaccttggc
ctggaaattagcatacactgtccttgtcatacttttcagcccaatggggacatcttggag
aatttgcacgaggtcttggagatcaagttcaaaggcattgacagtgaggatgactatggc
cgtggggacttggggcgcctgaagaagcagaaagacttgcataatccccacctcatcttg
atgatgttacccccacatcggctggagagcccagcgttgggaggccagagaaagaaacgg
gccctggataccaactactgtttccggaacctggaggagaactgctgcgtgcgtcctctg
tacatcgacttccgacaggaccttggctggaaatgggttcatgagcctaagggctacttt
gctaacttttgttcaggcccttgtccgtacctccgcagcgcagacaccactcacagcacg
gtgctgggcttatacaacacgctgaaccctgaggcatccgcttcaccctgctgtgtcccc
caggacctggagccactcactatcttgtactatgtcgggaggacccccaaagtggagcag
ctctccaacatggtggtgaaatcctgcaagtgcagctga

KEGG   Egretta garzetta (little egret): 104133428
Entry
104133428         CDS       T05152                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04060  Cytokine-cytokine receptor interaction
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104133428 (TGFB2)
   04350 TGF-beta signaling pathway
    104133428 (TGFB2)
   04068 FoxO signaling pathway
    104133428 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104133428 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104133428 (TGFB2)
   04218 Cellular senescence
    104133428 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:egz04052]
    104133428 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:egz00536]
    104133428 (TGFB2)
Cytokines and growth factors [BR:egz04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104133428 (TGFB2)
Glycosaminoglycan binding proteins [BR:egz00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104133428 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 104133428
NCBI-ProteinID: XP_009645123
LinkDB
Position
Unknown
AA seq 442 aa
MHCYLLSVLLTVDLATVAFSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPESKSSLP
CITLFEGTKYSIIKKKIKLHCLLADAIPPSYYSLYFRIVRFDVSAMEKNASNLVKAEFRV
FRLQNSKARVSEQRIELYQVLKSKELSSPGQRYIDSKVVKTRAEGEWLSFDVTEAVHEWL
HHRDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDDYTYSSGDVKALKSNRK
KYSGKTPHLLLMLLPSYRLESQQPSRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYHANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgcttctcaccgtggatctggccaccgtggctttcagc
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggcgatc
cgggggcagatcttgagcaagctgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaagag
aaagccaaccacagagctgccacttgcgagagggagaggagcgacgaggagtattatgcc
aaagaagtttacaaaatagacatgcagcctttttaccctgaaagtaagtcctctctgccc
tgtattacactgtttgaaggaacaaagtattctatcattaaaaaaaaaataaaattacac
tgccttcttgcagatgccatcccaccgagctattacagcctttacttccgaatcgtcaga
tttgacgtctcagcgatggagaagaatgcctccaacttggtgaaggccgagttcagggtc
ttccgcctgcagaactcgaaggcacgggtctcggagcagcggatagagctgtaccaggtt
ctaaaatctaaagagttatcatcaccaggacagcgctacattgacagcaaagtagttaaa
acaagagctgaaggagaatggttgtcttttgatgtcactgaggctgtacatgagtggctc
catcacagagacaggaaccttggatttaagataagcttacattgtccgtgctgcaccttt
gtgccttccaataattatatcatcccaaataaaagtgaggagcttgaagcaagatttgca
ggtattgatgactacacatattccagtggtgatgtgaaagctttaaagtccaataggaaa
aaatacagtgggaagaccccacatcttctgctaatgttattaccctcctacagacttgag
tcgcaacagcccagtcggcggaagaagcgtgctctagatgctgcctattgttttaggaat
gtgcaggataattgctgtctgcgtccactttatattgacttcaagagggatcttggctgg
aaatggattcatgaacctaaaggctatcatgctaatttctgtgcaggagcctgcccatat
ttatggagctcagatactcagcacagcagagtactcagcttgtataacaccataaatcca
gaagcctctgcctctccgtgctgtgtgtcccaggatttggaacccctcaccatcctctac
tacattggcaaaacacctaaaatcgaacagctgtccaacatgattgtaaagtcttgcaag
tgcagctaa

DBGET integrated database retrieval system