KEGG   Egretta garzetta (little egret): 104133729
Entry
104133729         CDS       T05152                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04060  Cytokine-cytokine receptor interaction
egz04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104133729 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    104133729 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:egz04052]
    104133729 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:egz00536]
    104133729 (IL4)
Cytokines and growth factors [BR:egz04052]
 Cytokines
  Interleukins
   104133729 (IL4)
Glycosaminoglycan binding proteins [BR:egz00536]
 Heparan sulfate / Haparin
  Cytokines
   104133729 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Glyco_transf_7N
Other DBs
NCBI-GeneID: 104133729
NCBI-ProteinID: XP_009645462
LinkDB
Position
Unknown
AA seq 138 aa
MSIRVPFLLTFLALSACQGRTATLPQTSTLLKESIRLLSNLETKVSCDKMNVTNIFAGDK
KANDTEMLCKAATIALESRDCHTHLEGIYLNLLSLIQRKSTAYKAPCPVAAGNTTSLKQF
LADLHRVLQQLVKDQSLK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagcatcagggtcccgttcctgctcaccttcctggcgctgtcagcctgccagggccgc
acggccactctgccgcagacctccaccttgctgaaggagagcatcaggctgctgagcaac
ctggagacaaaggtttcctgtgacaagatgaacgtgacaaatatttttgctggcgataag
aaagccaatgatacagagatgttatgcaaagctgccacaatcgccttggagagccgggac
tgccacacgcacctggagggcatttacctcaacctgctcagtctcatccaaaggaagagc
acagcctacaaggcaccatgtcctgtggcagcaggcaacactacttcactgaaacagttc
ctagcggacttacacagagtcctccaacaattagtaaaagaccagagcttgaagtga

DBGET integrated database retrieval system