KEGG   Egretta garzetta (little egret): 104133745
Entry
104133745         CDS       T05152                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00232  Caffeine metabolism
egz00983  Drug metabolism - other enzymes
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    104133745
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104133745
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     104133745
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 104133745
NCBI-ProteinID: XP_009645476
LinkDB
Position
Unknown
AA seq 295 aa
MDLQEYFTRISYNDSHQDADLQTLTVIFQHHIQAIPFENLSMHCGETIELDLQSTYNKIV
RKKRGGWCLESNHLLFWALQELGYDVCILGGNSYDPAEKAYKDELNHILLKVVIKGNSYI
VDAGFGGAYQAWQPLMLISGKDQPQIPGIFRFMEDNGTWYFEKVKRKHYIPEQNVPFTDT
SEPGNIRKIYRFTLEPRHVNDFQELNTYLQVCPENILQKKSICSLQTTEGLYALVGWTFT
EMKYNYMEDLDLVQITTLTDEEVEKTLKDKFKIVLENKLTPVNVRGLPPNLVDTM
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaccttcaagaatatttcacaagaatttcttacaacgattcccatcaggatgcagac
ttgcaaaccttaacagtcatcttccagcatcacatccaggcgattcctttcgaaaacctc
agcatgcactgcggagagaccattgaactggatttacaatctacttacaataagattgtg
agaaagaaacgtggtggatggtgcctggaaagcaaccaccttttattttgggccttgcaa
gaattagggtatgatgtctgtatccttggaggaaatagttatgatccagcagagaaggca
tataaagatgagttaaatcatatcctactgaaggtggtgatcaagggaaattcctacata
gtagatgctggttttggtggtgcctaccaggcgtggcagccattgatgttgatttctggg
aaggatcaaccccagatccccggcatcttccgcttcatggaagacaacggcacctggtac
tttgagaaagtcaaaaggaagcattatattcctgagcaaaatgtccctttcactgatact
tcagaaccggggaatatcagaaaaatctataggttcactctcgagccacgacatgtaaat
gactttcaggagctaaacacatacctacaggtgtgtccagagaatatacttcagaagaag
tcaatctgcagtctccagaccactgaagggctttatgccttagttggatggaccttcact
gagatgaagtataactacatggaggacctggacctggtgcagatcacaactcttacagat
gaagaggttgagaagacactgaaagacaaattcaagatagtgctggagaacaaacttaca
ccagtaaacgttcgtggcttgccacctaatttagtggatacgatgtaa

DBGET integrated database retrieval system