KEGG   Egretta garzetta (little egret): 104134399
Entry
104134399         CDS       T05152                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04020  Calcium signaling pathway
egz04260  Cardiac muscle contraction
egz04261  Adrenergic signaling in cardiomyocytes
egz04270  Vascular smooth muscle contraction
egz04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104134399 (CACNA1C)
   04020 Calcium signaling pathway
    104134399 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104134399 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104134399 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    104134399 (CACNA1C)
   04270 Vascular smooth muscle contraction
    104134399 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:egz04040]
    104134399 (CACNA1C)
Ion channels [BR:egz04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104134399 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 104134399
NCBI-ProteinID: XP_009646229
LinkDB
Position
Unknown
AA seq 2119 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLMDTPAEDDPSPCAPQSAHGRQCQN
GTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSL
VIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDID
PENEDEGMDEEKPRNMSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRR
WNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFT
AEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIF
KITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRST
FDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNCILXXXF
LAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKS
ITADGESPPATKINVDDYQPNENEEKSPYPTTEVPAEEDEEEPEMPVGPRPRPMSELHLK
EKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSF
RNQILFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQS
SAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
QLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWENSKFDFDNVLTAMMAL
FTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVT
FQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNAKNLNRKGGQE
GPCGFLTSWYRRSSRCWRDAIFQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPK
GYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRL
VKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRN
NNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYF
ISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLD
VVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEG
NLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKE
QGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIF
RRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPS
SYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTIHVQEAPWKIPSKSS
SSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNK
GEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGL
SPLLQRSHSPTMFSRLCATPPATPCSRGWPQQPIPTLRLDGAESSEKLNSSFPSVHCSSR
YTDNSGCSSPRRARPVSLTVPSQTGGSSRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEV
TTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNP
DCRKSQEELKDSRIYISSL
NT seq 6360 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcagctgcagggcttgccccagagcatatccctactccaggggcagct
ctgtcctggcaagctgcgattgatgctgccaggcaagccaaactgatgggtagtgctggc
aatgcaacaatatccacagctagctccacgcagaggaaacggcagcagtatgggaaacag
aaaaaacagggtaccaccacagctacacgtcctccccgggcactgctgtgtttaacactg
aaaaatcccatccggagggcatgcatcagcatcgtcgaatggaaatcatttgaaataatt
attttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaa
gatgattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataatt
tttacagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgct
tacctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagt
gcaattttagaacaagcaaccaaagcagatggggggaattcaataggaggaaaaggtgcc
ggattcgatgttaaagcactgcgggctttccgagtattacgtccgttacggctggtgtct
ggagttcctagtctccaggtggttttaaattcaattatcaaggccatggtccctttgttg
cacattgccctgctggtgctgtttgtcattattatctatgccatcattggactggagtta
ttcatggggaagatgcataaaacctgctaccatgtgcaaggaggacttatggatacacct
gcagaagatgatccgtctccctgtgccccccagtctgcgcatgggcggcagtgtcagaac
ggcacggagtgcaaggcaggctgggagggtcctaagcacggcattacaaactttgacaat
tttgcttttgccatgctgacggtgtttcagtgcatcacgatggagggctggacagatgta
ctgtactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctg
gtcatctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttt
tccaaagaaagagagaaggctaaggctcggggcgatttccagaagttacgagaaaaacaa
cagctagaggaggatttgaagggatacttagactggataactcaagcagaagatattgac
ccagaaaatgaagacgaaggcatggatgaggagaagccccgaaacatgagcatgcccacc
agtgagactgagtccgtgaacacagacaacgtccctggagcagatattgaaggcgaaaac
tgcggtgctaggctagcgcatcggatctcaaaatcaaagtttagtcgctactggcgccga
tggaatcgattctgcagaagaaagtgccgcgctgctgtcaagtccaatgttttctactgg
ttggtgatcttccttgtgtttctcaacacccttaccattgcctctgaacactacaaccag
ccagactggctcacagaggtccaagacactgccaataaggtgctgctagctcttttcacg
gcagagatgctgctgaagatgtacagccttggtctccaggcctattttgtgtccctcttc
aaccgctttgactgtttcattgtgtgtggaggaatcctggaaacgattctggttgagaca
aagatcatgtcaccactgggcatttcggtgttgagatgtgttcgactcctaagaatattc
aaaatcacaagatactggaactccctgagtaatcttgtggcttcgctcctgaattcagtc
cgctccattgcctccctgttgctgcttctcttcctcttcataatcatattctcactcctg
gggatgcagctctttgggggcaagtttaactttgatgagatgcagaccaggaggagtacc
ttcgacaacttcccccagtccctcctcactgtgtttcagatcctgactggggaggactgg
aattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttg
gtctgtatttacttcatcatcctcttcatctgtggaaactgtatcctnnnnnnnnnnttt
ttggccattgctgtggacaaccttgctgatgctgagagtttaacatctgcacagaaagag
gaggaagaggaaaaagaaaggaaaaagctagctaggactgctagtcccgaaaagaaacag
gagatagaaaaaacagctgtggaggaggagacaaaggaggagaaaattgagctgaaatca
atcactgctgatggagaatccccacctgctaccaagatcaacgtggatgattatcagccc
aatgaaaatgaagaaaagagcccatatcccacaacagaagtgccagcagaggaagatgag
gaagaacccgagatgcctgtcggccctcggcctcgcccgatgtctgagctgcacctcaag
gaaaaggctgtgcctatgcctgatgccagtgcttttttcatcttcagtcctaacaacagg
tttcgtgtccactgccatcgaatcgttaacgataacattttcaccaacctgatcctattt
ttcatcttgctcagcagcatctccctggcggctgaggaccctgtccgacacctctccttt
aggaaccaaattctcttttattttgatatagtttttactgtcattttcaccattgaaatt
gctctgaagatgactgcatacggggctttcctccataagggctccttctgcagaaactat
ttcaacatcttagacctgctggtggtcagcgtttctctcatctcttttgggatccagtcc
agtgctatcaatgtggtgaagatcctgcgtgttctgcgagtgcttagaccactgagggcc
atcaacagagccaaaggactaaagcatgtggtccagtgtgtgtttgtcgccatccgaacc
atcggaaacattgtaatcgtcaccactttgctgcagttcatgtttgcctgcattggagtt
cagttgttcaagggcaagctgtacagctgcactgatagctccaagcagacagcagcagaa
tgcagagggtactacattacatacaaggatggtgaggtcaaccagccgatgatacagccc
cggagctgggagaacagcaagtttgacttcgacaatgtcttgactgccatgatggccctc
tttactgtctcaacctttgagggctggccagagttgctgtataggtccattgattcccac
atggaggatgtgggacccatctataatcacagggttgagatctccatcttctttattatc
tacatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcaca
tttcaggaacaaggagaacaagagtacaagaactgtgaactggacaaaaaccagcgccag
tgtgtagaatatgccctgaaggcccggcccctgcggagatacatccctaaaaaccagtac
cagtacaaagtttggtatgtggtcaacgcaaagaacctcaacaggaagggaggtcaggag
ggaccctgtggattcctaaccagctggtatcgtcgttcctcacgctgctggcgggatgct
atttttcagcactacggtcagagctgcatgttcaaggaagccatgaacatcctcaacatg
ctcttcactggcctcttcactgttgagatggtcctgaaattaatcgccttcaaacccaag
ggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagcattata
gacgtcattctcagtgaaactaatccagctgaacatacccaatgctcttcctctatgaac
gcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgcgtgatgcgtctc
gtgaagctcctgagccgaggggagggcatccggacgctgctttggaccttcatcaagtcc
ttccaggctctcccctatgtggctcttttaatagtgatgttgttcttcatctacgctgtg
atcgggatgcaggtgtttggtaaaattgcgctgaacgataccacagaaatcaaccgcaac
aacaacttccagaccttcccccaggcagtgctgctgcttttcaggtgtgccaccggtgag
gcctggcaggaaatcatgctggcgtgtctcccagacaaaaagtgcgacccggagtcggag
ccagccaactccactgaagccgatcactcctgtggcagcagctttgccgtcttctatttc
atcagcttctacatgctctgtgccttcctgatcatcaatctttttgtagctgttataatg
gataactttgattacctgacacgggactggtccattttaggaccacaccacctggatgag
tttaaaaggatctgggcagagtatgaccctgaagccaagggacggatcaaacacctggac
gtggtgacactgctccggcggattcagccccccctgggcttcgggaagctctgccctcac
cgggtggcttgcaaacgccttgtctccatgaatatgccactgaacagtgatgggactgtc
atgttcaatgccactctctttgcgttggtcagaacagcactgaggatcaagactgaaggt
aacctggagcaagccaacgaagagctgagagcaataattaagaaaatctggaagcgcacc
agcatgaagctgctggaccaggtggtgccccccgcaggtgatgacgaggtgaccgttggg
aagttctacgccactttcttgatccaggagtatttccggaagttcaagaaacgtaaagaa
cagggactggtgggcaagccctcccagcgcaacgcactctccttgcaggctggtctgcgc
acacttcatgacattgggccagagatccgacgagcaatttctggagacctgacagctgaa
gaagagcttgacaaggccatgaaagaagctgtttctgctgcctctgaagatgatatcttc
cggagagccggaggcttgtttggaaaccatgtcagctattaccaaagtgatggcaggagc
gcattcccccagacattcaccacccagcgacctttgcacatcaataaatctggcaacaac
cagggagataccgagtctccgtctcatgagaagctggtggactccaccttcacacccagc
agctactcatcttcaggctccaacgccaacatcaacaatgccaacaacaccgccctgtgc
cgcttccccagcccacccagctaccccagcactgtcagcacagtggaaggccatgggacc
cccttgtcacccaccatacatgtgcaggaggctccttggaaaataccttccaaaagctcc
agttccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgagact
tatgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctctctact
gaaatgctcgcataccaagatgatgaaaacagacaacttactccaccagaaaacaacaaa
ggagaggacacccggcactctccaaagaaagggtttctgtgctcctcagcactaggtcga
agagcatcttttcacttagagtgtctgaaaagacagaaaaaccagggcgtagatgtctcg
cagaagacagttctacctttgcatctggtacatcatcaggcgctagcggtggccggcctg
agtcccctgctccagcgaagccattcccccaccatgttctcccggctgtgcgctacgccc
cccgctacaccctgcagccgtggctggccgcaacagcccatcccgactctgcgcctcgac
ggggcagagtccagcgagaagctcaacagcagcttcccatccgtgcactgcagctctcgg
tacactgacaacagcggctgcagcagcccgaggagagccaggccggtctccctcaccgtc
cccagccagaccggagggagcagcaggcagtttcacggcagcgctggcagcctggtcgaa
gcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtc
acaacccaggagctcgcagacgcctgtgacatgacgatagaagagatggaaaatgcagca
gacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttgccttttgtt
aactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccg
gattgtagaaaaagtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system