KEGG   Egretta garzetta (little egret): 104134824
Entry
104134824         CDS       T05152                                 

Gene name
STAT3
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04217  Necroptosis
egz04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104134824 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104134824 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104134824 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:egz03000]
    104134824 (STAT3)
Transcription factors [BR:egz03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104134824 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 104134824
NCBI-ProteinID: XP_009646705
LinkDB
Position
Unknown
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSAXPQRFLCFSLPPSDSTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagctttcccatggagctccggcagttcctggccccatggattgagagc
caggactgggcatacgccgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagtccaatgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagcccgcattgtggctcgctgcctgtgggaagagtcgcggctcctccagacggctgcc
accgcagcccagcaagggggacaggcaacacacccaacagcggctgtagtgacggaaaag
cagcagatgctggagcagcatctgcaggatgtgaggaagagggtacaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcggtgacccggcagaaaatg
cagcagctggaacagatgctcacggcgctggaccaaatgcgaaggggtattgtgagtgag
ctggctggactgctgtcagccatggagtatgtgcagaagatgctggcagatgaggaactg
gcagactggaagagacggcagcagatcgcctgcattggtggcccaccaaatatctgctta
gaccggcttgagaactggataacctctcttgccgaatcacagctacagacccggcagcag
atcaagaagttggaagaactgcagcagaaagtgtcctacaagggtgacccaattgtccaa
caccggcccatgctggaggagcggattgtggagctgtttaggaacctgatgaaaagtgct
ttcgtcgtggagaggcagccctgcatgcccatgcaccctgaccggcccttggtcatcaaa
accggtgtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaattaaagtctgcattgacaaggactctggggatgttgcagcacttcggggg
tcccggaagtttaacatcctggggacaaacaccaaggtcatgaacatggaggagtcgaac
aacggcagcctctcagcagagttcaagcacctgaccctgcgggagcaacggtgcggtaat
ggcggcagagccaactgcgatgcctcattgatagtcactgaggagctgcacctcatcacc
ttcgagacagaagtgtatcaccaggggctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccatcgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacgaagcgtggcctc
agcattgagcagctgacaacgctggcagaaaaacttctaggaccaggtgtgaattactct
ggctgccagatcacctgggccaagttttgcaaggagaacatggctggcaaaggcttttcc
ttctgggtctggctggacaacatcattgacttggtgaaaaagtacatcctggcgctgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcact
aagcctccgggaaccttcctgctgcggttcagtgagagcagcaaggaaggtggcatcacc
ttcacgtgggtggagaaggacatcagcgggaagacccagatccagtctgtggagccttac
accaagcagcagctgaacaacatgtcgtttgcggagatcatcatgggctacaaaatcatg
gatgccaccaacatcttggtgtcccccctggtgtacctgtacccagacatccccaaggag
gaggcctttgggaagtactgccgctctgagagccaggagcactccgaagctactgactca
gcctgaccccagaggtttctgtgcttttcccttcctccctcggacagcacctccttcagc
aacaccatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagtttggcaac
agcagcgagggagcagaggccaacgcaggagggcagtttgagtcactgaccttcgacatg
gagctgaccccggagtgtgcttcttcaccgatgtga

DBGET integrated database retrieval system