KEGG   Egretta garzetta (little egret): 104134883Help
Entry
104134883         CDS       T05152                                 

Gene name
ACE
Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:egz01002]
    104134883 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104134883 (ACE)
   04090 CD molecules [BR:egz04090]
    104134883 (ACE)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104134883 (ACE)
Peptidases [BR:egz01002]
 Metallo Peptidases
  Family M2
   104134883 (ACE)
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104134883 (ACE)
CD molecules [BR:egz04090]
 Proteins
  104134883 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 104134883
NCBI-ProteinID: XP_009646774
LinkDB All DBs
Position
Unknown
AA seq 1275 aa AA seqDB search
MPPVLGLLLGLSLVGALQPDLNPPQHEPTEQGATLFASAYNSTAEIVLFKSVSASWNYYT
NLTAENAALQVEASLEEQNFTELWGKKAKELYGNIWKNFSDPDLKRIIGSIQTLGPSNLP
LEKRQQYNTILSEMDKIYSTAKVCLANDTCWELEPDISDIMANSRSYKKLLYAWEGWHNA
AGNPLRTKYEEFVNLSNEAYHMDGFEDTGSYWRSWYDSPSFEDDLEHLYKQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWSQQWNNIYDLMVPYPEKPNLDVTSTMVQK
GWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRRGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSSATEDKESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPNRYNYDWWYL
RTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPLH
TCDIYMSKEAGAKLREVLKAGCSKPWQDILFNLTGTNRMDAGALLEYFSPVTQWLQEQNN
KTNEVLGWPEFDWRPPIPEGYPEGIDKIADEAQAKEFLSEYNSTAEAVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDQSVTRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKIKNNYKRYVELSNKAAVLNGQLSNSFYXKNETPTFEEDLERLYLQLQPLYFNLHAYVR
RALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKKQGWTP
KRMFQESDNFFTSLGLIPMPQEFWEKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQCTV
VNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVIALSVSTPKHLHHIHL
LDQVTNNKESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLRMKY
QGLCPPAPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCAAANHTGPLHTCDI
YESKEAGKILGDALKLGFSKPWPEAMKLITGQPNMSADALMRYFEPLMQWLVKENEKNGE
VLGWPEYSWTPYADQASSSRTDFLGMSLTSSQATAGSWVLLALALIFVITTIFLGFKFFS
ARKKAFKSSSEMELK
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggtgctggggctgctgctggggctgagcctggtgggtgcccttcagcccgac
ctcaatcccccccagcatgagcccaccgagcaaggggccaccctcttcgccagcgcctac
aacagcacagctgagatcgtcctcttcaagagcgtctcggccagctggaattactacacc
aacctgacggccgaaaacgctgctctgcaggtcgaggcatcgctggaggagcaaaatttc
acggagctgtgggggaagaaagccaaggagctctatggcaacatatggaagaacttcagc
gacccagacctgaagagaatcattggctccatccagaccctgggaccctccaacctgccc
ctggagaagagacagcagtacaacaccatcctgagcgaaatggacaaaatctactccaca
gccaaggtgtgcctggccaatgatacctgctgggagctggagccagacatctcggacatc
atggccaactcccgcagctacaagaagctgctctacgcctgggagggatggcacaacgct
gcgggcaacccgctgcgcaccaagtacgaggagtttgtgaatctgagcaacgaggcctac
catatggatggattcgaggacacaggcagctactggcgctcctggtatgactcaccctcc
ttcgaggatgacctggagcatctctacaaacagctggagccactctacctcaacctgcac
gccttcgtccggaggaagctgtatgaccgctatggccccaaatacatcaacttgaagggt
cccatccctgctcacctcctgggcaacatgtggtctcagcagtggaacaacatctatgac
ctgatggtcccctatcctgagaagcccaaccttgatgtcacgagcaccatggtgcagaag
ggctggaacgccacccacatgttccgggtctcagaggagttcttcacctccctggggctg
ttggagatgccccccgaattttgggagaagtccatgctggagaaaccaacggatggacgg
gaggtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
cagtgcacaacagtgaccatggagcagctgttcacagtgcaccatgagatgggccacgtc
cagtactacctgcagtacaaggaccagcccgtctccttccgcagaggggccaaccctggc
ttccatgaggccattggcgatgtcttgtccttgtctgtctccacccccagccacctcaag
aaaattggtctcctcagcagtgccaccgaggacaaagagagcaacatcaactatctgctg
aagatggccttggagaagatcgccttcctgcccttcggctacctcatcgaccaatggcgt
tggaacgtgttcagtggccacacgcccccgaaccgttacaactacgactggtggtatctg
agaaccaaataccagggtatctgtgctccggtttcgaggaatgaaagcaactttgaccct
ggagcaaagtaccacatccctgggaacaccccatacatcaggtactttgtgagcttcatc
ctccagttccagtttcacaaggcattgtgccaagcggccaaccacaccggtcccctgcac
acctgtgacatctacatgtccaaagaggctggagccaaactcagggaagtgttgaaagct
gggtgttccaagccatggcaggatatcctgttcaacctcaccggcacgaataggatggac
gctggggccctcctggagtacttcagccctgtcacccagtggcttcaggagcagaacaac
aagaccaatgaggtgctgggctggcctgagtttgactggcgtccccctatccctgaaggc
taccctgaaggcattgacaagatagcagatgaagcacaagctaaagagttcttgtccgag
tacaacagcacggctgaggcagtgtggaacgcctacactgaggcatcctgggcctacaat
accaacatcacggaccacaacaaggagatcatgttggagaagaacttggccatgtccaag
cacacccttgagtatggcatgagggccaggcagttcgacacctccgacttccaggaccaa
agtgtcacacgcatcctcaagaagctgagtgtcattgagagggcagccctgcctgagaat
gagctgaaggagtacaacaccctcctctcagatatggagaccacgtacagtgtagccaag
gtctgcagagagaacaaaacctgtcaccccctggatcctgacctcacagatatcatggcc
acctcacgggactatgatgagctcctctttgcctggaagggctggcgggatgcttctggg
aagaagatcaagaacaactacaagcgatacgtggaactgagcaacaaggcagctgtgctc
aatggtcagttgtctaacagcttctattaaaaaaacgagacacccaccttcgaggaagat
ctggagaggctgtacctgcagctgcagcccctgtacttcaacctgcatgcttacgtacgc
cgagccctatacaaaaagtatggtgcagagcacataaacctgaagggtcccatccctgct
cacctgctaggcaacatgtgggcccaatcatggtccaacatttttgacctggtgatgcct
ttcccggatgccaccaaggtggatgccaccccagccatgaaaaaacagggctggacaccc
aagaggatgtttcaagagtcggacaatttctttacctctctgggcctcatccccatgccg
caggagttctgggagaagtccatgatcgaaaagccatcagatgggcgcgaggtggtgtgt
catgcctcggcctgggacttctacaaccgcaaggacttcaggatcaagcagtgcaccgtg
gtgaacatggatgacctaatcacagtgcaccatgagatgggccacgtccagtacttcctg
cagtacatggatcagcccatctcattccgtgatggggccaatcctggcttccacgaggcc
atcggggatgtcattgccttgtccgtctccacccccaagcacctgcaccacatccatctg
ctggaccaagtcacaaacaacaaagaaagtgacattaactacctgatgagcatcgctctg
gacaaaatcgccttcctacccttcggatacctcatggaccagtggcgctggaaggtgttt
gatgggaggatcaaggaggatgaatacaaccagcagtggtggaatctcaggatgaagtac
cagggcttgtgcccgccagcgccaaggtctgaagatgactttgaccccggggcaaagttt
cacatccctgccaacgtcccctacatcaggtacttcgtcagctttgtgatccagttccag
ttccaccaggcgctctgcgcggcagccaaccatacgggtcccctgcacacgtgtgacatc
tacgagtccaaggaggctgggaagatcttgggggatgccctgaagctgggtttcagcaag
ccgtggcccgaagccatgaagctcatcacagggcagcccaacatgtcagctgatgccctg
atgagatactttgagccactcatgcaatggctggtgaaggagaacgagaagaacggggag
gtcctgggctggcccgagtacagctggactccttacgcagaccaagccagctccagccga
actgatttcctgggcatgtccctgaccagcagtcaagccacagcaggcagctgggtcctg
cttgccctggcacttatcttcgtgatcactaccatcttcttgggcttcaagttcttctca
gccaggaaaaaggccttcaaatccagctcagaaatggaactgaaataa

DBGET integrated database retrieval system