KEGG   Egretta garzetta (little egret): 104134931Help
Entry
104134931         CDS       T05152                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    104134931 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    104134931 (HDAC1)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104134931 (HDAC1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     104134931 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     104134931 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    104134931 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    104134931 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 104134931
NCBI-ProteinID: XP_009646827
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAV
QEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKRVKTEEEK
EEEEKKDEKEEEKAKEEKAEPKGVKEETKST
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccacaggatccggatgactcacaacctattgctgaactatggcctctacagg
aagatggagatatatcgccctcacaaggcaaatgcagaagaaatgaccaagtaccacagt
gatgactacataaaatttctgagatctattcgcccagataacatgtctgagtacagcaag
cagatgcaaagatttaatgttggggaagactgccctgtgtttgatgggttgtttgagttt
tgtcagctctctgctggaggctcagttgccagcgctgtgaagctgaacaagcagcagaca
gatattgctgtgaattgggcgggaggccttcaccacgctaagaagtcagaggcttctggc
ttctgttatgtcaacgatatcgtcttagctatcttggagctcctaaagtatcaccagaga
gtgctgtatattgacattgatattcaccatggagatggcgtggaggaagccttttatacc
acagaccgtgtcatgaccgtgtcctttcataagtacggagaatacttcccgggaacaggg
gacctacgggatattggtgcaggcaaaggcaagtactacgctgtcaactatcccctccga
gacggaattgatgacgagtcctatgaagcgatattcaagccggtgatatctaaagtgatg
gagacgttccagcctagcgcagttgtcttgcagtgtgggtcagattctctgtcgggggac
aggctgggttgttttaatctgaccatcaaaggtcatgccaagtgtgtggagtttgtaaaa
agttttaatttgcctatgctgatgctgggaggaggtggctatacgatccgcaacgtggct
aggtgctggacctatgagactgctgtggctttggacactgaaattcccaatgaactccca
tataatgactattttgagtacttcggaccagactttaagctccacatcagtccctcgaac
atgactaaccagaataccaatgagtatcttgagaagatcaagcaacgtctcttcgagaat
ctgcgcatgctgcctcatgcccctggtgtccagatgcagccaattcctgaggatgctgtt
caggaagacagtggagatgaagaggaagaagatcctgagaaacgcatttcaatccgcaat
tccgataagagaatatcctgtgatgaagaattctctgactctgaagatgaaggggaagga
gggcgcaaaaacgtcgccaactttaagaaagctaagcgtgtgaaaacagaagaggaaaag
gaggaagaggagaagaaagatgagaaagaagaggaaaaagcaaaagaggagaaagcagaa
cccaaaggggtgaaggaagaaacgaaatccacctga

DBGET integrated database retrieval system