KEGG   Egretta garzetta (little egret): 104135134Help
Entry
104135134         CDS       T05152                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00500  Starch and sucrose metabolism
egz01100  Metabolic pathways
egz04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104135134 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    104135134 (GYS2)
Enzymes [BR:egz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104135134 (GYS2)
Glycosyltransferases [BR:egz01003]
 Polysaccharide
  Storage polysaccharide
   104135134 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 104135134
NCBI-ProteinID: XP_009647043
LinkDB All DBs
Position
Unknown
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPLEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLVGPYFEHNVKTQVEPCEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWDVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDNKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLNKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVSDPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSEG
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgacttctcttaacgggcttcctcagtgggaggat
gaagacctgccactggaggatttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaattacagcagatgaatggggt
gaaaactattttctggttggtccctattttgagcacaatgtgaagactcaggtggaacca
tgtgagcctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgt
caggttttttttggaagatggctgatagagggcagcccatatgtcttactgttcgatata
ggatcagcagcctggaatctggacaagtggaaaggcgaattttgggatgtcagcaacata
gggatcccttttcatgaccgagaagccaacgatgctgtaatttttggatcattaacagcc
tggtttttaaaagagctttcctgtcagtttgataacaagcccaacataattgcccacttc
catgagtggcaggcaggagtgggtttaatactttctcgatctcagaaacttcctgttgcc
acaatttttactacccatgcgactctacttgggagatacctgtgtgcagccagtatagat
ttttacaacaatcttgaccagtttgacatcgacaaggaagcaggagagagacagatttac
catcggtactgtatggaacgggcatctgtgcattgtgcccatgtgttcaccacagtctca
caaataacagctatagaagcagaacatatgcttaaaagaaatcctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgagaagaccttatttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcataagactgat
gttacagttgttgtgttcttcatcatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaacgccttgctaaaaggagaaattccagacttgaacaagatt
cttgaccgagatgatataaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgcctccagtgaccactcacaacatgattgatgatggcaacgatccaatcctcaatact
attcgacgcattggtcttttcaataaccgaacagacagagtaaaggtgatcctacatcca
gagtttctttcttcaacaagcccactgctgcccttggactatgaggagtttgttagaggc
tgccacctcggtgtatttccatcatactatgaaccctggggttacactccagctgaatgt
actgtgatgggcattcccagtgtaaccacaaacctttctggattcggctgtttcatgcag
gaacatgtttctgacccagcagcttatggcatctacatagttgacaggaggttccgctca
cctgatgaatcatgcaaccagctgactcagttcctgtacggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagagactctcagatcttttggactggaga
tacctaggcaggtattacatgcatgccagacacctggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcagtgccaccatcaccttctgtgtctcagcattccagccctcaccatagcgaaggc
gaagacgaagatgaggatgaaagatatgacgaggatgaggaagctgaaagggataggcaa
aacatcaagtctcccttttcccttggtgtattgccgcaaggaaaaaagaagcagcatgga
gaatacaggaactga

DBGET integrated database retrieval system