KEGG   Egretta garzetta (little egret): 104135361Help
Entry
104135361         CDS       T05152                                 

Gene name
KMT2A
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 2A
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104135361 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:egz03000]
    104135361 (KMT2A)
   03036 Chromosome and associated proteins [BR:egz03036]
    104135361 (KMT2A)
Enzymes [BR:egz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104135361 (KMT2A)
Transcription factors [BR:egz03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    104135361 (KMT2A)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104135361 (KMT2A)
   HMT complexes
    MLL-HCF complex
     104135361 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET FYRN PHD zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 104135361
NCBI-ProteinID: XP_009647291
LinkDB All DBs
Position
Unknown
AA seq 3794 aa AA seqDB search
MEKVKKKELKSGEKRRGRPPTLTSVKFKLSQVKDASDVQKGSKEEKDSLKKIKRSPSTTF
QQATKIKKLRTSKLSPLKSKFKPGAKLQIGRXXXXXXXXXKSVQIARRRGRPPSSERLKT
SSTLVINSQLEKPQRIRKEKDGTPPLTKEEKTAVRQSPRRIKPVRIIPSTKRTDAAIAKQ
LLQRAKKGAQKKIEKEAAKLQGRKGRTQLKNIRQFIMPVVSAISSRIIKTPKRFIEDEDY
DPPIKISRLESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASE
EMQTLSEERSNTPEVHTPLPVSQSPENDNGDRRNRRFSITERSFGQRTAKKLSALPSVPQ
QQSSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASAAPMQEKRKSILRE
PTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTTGATA
PARLFSLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLSSSVGRTTTGTSATGVSS
RKRKRRVFSPIRSEPRSPSHSMRTRSGRLSTSDLTTLTPQSSVSSSLTSISVSSLATSAL
NSTFTFPSHSLTQSGESAERSQRPRKQTSTPAEPFSSSSPTPLFPWFTSSPQTERGRNKD
RAAEELSKDKDADKSLEKDKSREKDREREKENKRESRKEKRRKGSEIQSSSALFPVGKMP
KEKVVSEDVAASSSAKKTAGRKKSTAIDPAADGSSAALVDTAAIKTKTSKKGRGGLDKSD
LDLSPAVPSLEKEKALRLSAPSSSAVKHSASSISSMLAQADKLPMTDKRVASLLKKAKAQ
LYKIEKSKSLKQADQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTL
SALPWEEREKILSSMGNDDKSSIAGSEEAEPLAPPIKPIKPVTRNKAQQEPPVKKGRRSR
RCGQCSGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAA
KKKEKKSKTNEKKESHSGKNQLDSGQKQTPQTIISREDNAAKKSSEPARKPVEEKHEDGN
SSVPVSEPKQVPASGTRKAGKQASQPVQLPPSQPPSSGPLKKEAPKLTTSEPKKKQTPQP
EIGTEQSKQKKIAPRPTFPVKQKPKEKEKPPPISKPESSTLNLLSTLTNGSSSKQKPPTD
GVHRIRVDFKEDCEVENVWEMGGLGIVTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFH
KFCLEESERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPT
KPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCY
DDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCINCTEQHPAEWRLAL
EKELQVSLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTE
VSKQEEQQPLDLEGVKRKMDQGCYTAVLDFSDDIVKIIQAAINSDGGQPEVKKANSMVKS
FFIRQMERVFPWFSVKKSRFWEPNKVTSNSGMLPNAVLPPSLDHNYAQWQEREESNRTEQ
PPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPISSSDRSREDSPELNPPPDVEDNRQCALC
LKYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFC
QKSGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVLRR
VFVDFEGISLRRKFLSGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYW
STTDARKRCVYTCKIMECRPPVIEPDINSTVEHDDNRTIAHSPVPLTETLPKDSRNTPEI
VNPPSPDRPLHSQTSSSCYYPAVSKGPRIRTPSYPSTQRSPGSRPLPSAGSPTPVTHEIV
TVGDPLLSSGLKSIGSRRHSTSSLSQQQSKLRMISPTRAGNTYSRHSVPSVSGMGSSSEH
EPSIKSTDRFVGSVNAGAPSAPVQSCSASSGSQKTAATSGSKTYQLDASQSTEGKHSSSS
DSIAKGAPLKGEKMKTVTSKDPDYSAHSFASGGNSKMSTQPTTSSSGAEMNVKIGTFQEC
SGSFSSKEAISFPPLHQRGPRKDRDQHVEPVQPEKTAVVDEMDVKTLKSAGVNSRSPAAS
EQVVSAPRDRRQKGKKLMKDSFKEKHSLKSLPDSSQAVGSDEGNLKPEFGNQGLATEQTS
QRLCNNIPAEKAGEKSPPSQGASKGSAAQIEVAPKESQAPRKRTVKVTLTPLKMESENQS
KNAQQEGDAEPQSAGAELAALAEPSSTSESPEDNPAVQGSPNEAPAQEAQNNAYENLPVQ
DNNLMLQDGSKAQEEGSYKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSNSTGK
KRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVVSSNTEERLASHNLFREEEQCDLPKI
SQLDGVDDGTESDTSVTATTRKVSQVTKRSGKENGTENLKLDRTEEAGEKVQVTKSSAVH
KTDPKIDNCHPVSRVKAQGQDSLEAQLSSLETGRRAHASTPSDKNLLDTFNTELLKSDSD
NNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNRGKDMGLF
EVFSQQLPTAEPXDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNHNRLAVISE
SSLSSSGERSMLALPSTESGEKRVTVTEKSASGEGDTALLSPGVDPSPEGHMTPDHFIQG
HIDAEHIASPPCGPVEQGHGSNQDLTRNSGTPGIQVPVSPTVPLQSQKYVPNSTDSPGPS
QISNAAVQTTPPHLKPAAEKLLVVNQNMQPLYVLQTLPNGVTQKIQLTPSVSSAQSVMET
NTSVLGPMGSGLTLTTGLNPSLPSSQSLFPPTSKGLLPMSHHQHMHPFSTATQTGFPPNI
SSPSPGLLIGVQPPPDPQLLVSEASQRTDLGTTASTPAAVLGKKRPISRLQSRKNKKLAP
SGNPSAIAPPDMVSNMTLINFAPSQISNHPLDLGTIANSTSHRTVPNIIKRSKSGVMYFE
QTSLLPQGGTTTAVGTSPSVIGPDASHLPAGPVSGLASSSSVLNVVSMQAAAAPTTGGSV
PSHVLGQNSVTLTSPGLLGDLGSISNLLIKASQQSLGLQEQHVTLPPSSGMFSQLGASQT
PSTAAMTAASSICVLPSAQTMGMTVAPSSTDPEGSYQLQHMTQLLASKTGVASSQLDLST
ASATTQLSSFPQLVDVPNSTGLEQNKASSSVMHASSASPGGSPSSGHQSASSSVLGPTKM
KPKIKRIQPLLDKGNGKKHKTSHVWTSSSEAHVPDRGATAVPQVSATGTPAMKADTQDAA
SVDQPSQKQCGQSAGQTAALPESQSTQNSTNEQENAGSKALEEEESTFSSPLMFWLQXQK
SKECLGEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVN
GLRMLGIIHDTVVFLIEQLYGAKHCHNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAF
DMFNFLASKHRQPPEYNPNDEEEEEIQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYR
SPIHGRGLFCKRNIDAGEMVIEYSGNVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDA
TMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKL
PCNCGAKKCRKFLN
NT seq 11385 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtaaagaagaaggagttgaagagtggggaaaaaagacgaggaagacctcca
acgcttacgagcgtgaagttcaaattgtcacaagtaaaggacgcatcggacgttcagaag
ggcagtaaagaagaaaaagacagtctgaaaaaaatcaaaaggtccccatccactacattt
cagcaagcaactaaaatcaagaaattaagaactagtaagctctccccactgaaatctaaa
tttaagcctggggcgaaacttcagattgggaggannnnnnnnnnnnnnnnnnnnnnnnnn
aagagcgttcagattgcacgcaggagaggtaggccgccgtcctcggaacgcttaaagact
tcctcgaccttagtcataaactcgcagctggagaaaccccaaaggattcgcaaagaaaag
gatggcacgccacctcttacgaaagaagaaaagactgctgtcagacagagtccgcgcagg
atcaagcccgttaggattataccttccaccaaaaggacggatgctgcaattgctaagcaa
cttctgcagagggctaaaaagggggcgcaaaaaaagattgagaaagaagcagccaaactg
cagggcaggaaggggagaacccagctcaaaaatatccgacagttcatcatgccggttgtg
agcgctatctcttcacggattattaaaacacccaaacggttcattgaggacgaagactac
gatcctcctattaaaatatccagactagaatccacaccaaacagcaggttcagcgccacg
tcttgtggctccagtgaaaagtccagcgctgcttctcagcattcgtctcagatgtcttca
gactcctcacggtccagtagccccagcgtggatacgtctacagactcccaggcttccgag
gagatgcagacgctttctgaggagcgcagcaatactccagaagttcacacgccgctgcct
gtttctcagtcccctgaaaacgataacggcgataggcgaaacagaagattttcgataacg
gaaagaagttttggccagaggactgctaaaaagctgtcagccttaccaagtgtgccgcag
cagcagtcctcctcctctcctcctcctcctttgctcacacccccgccaccgctgcagcct
gcttccagcatctcggaccataccccttggcttatgcctcctaccataccgttagcctca
ccctttcttcccgcttctgctgcgccgatgcaagagaaacggaagtcgattctgcgagag
ccgacgtttaggtggacctccctgaagcattccaggtcagaaccacagtacttctcatcg
gcaaaatacgccaaagagggtctcatccgcaaaccgatattcgataacttcaggccccca
ccgctgacaccggaggacgttggctttgcgtccggcttctcaacgacaggtgctacagcc
ccggcacgtctgttttctcttcactctggaacaaggtttgatatgcacaagagaagccct
ctgctgcgagcgcccagattcacgccgagcgaggcccactccaggatctttgaatccgta
actctgtcctcatcggttggccgaaccactacagggacctctgcaacgggtgtctcctct
cggaagcggaagaggagggtgtttagccccatccgatcggaacccagatctccttcgcac
tccatgaggacgagaagcgggagacttagtacctctgacctgacaactctcaccccacag
tcttctgtctcttcctcattaactagcatttctgttagttctcttgccactagtgcctta
aattcaacttttacttttccttcccattccctaacgcagtccggggaatcagcagaaaga
agccagaggccaaggaagcagactagcactccggcagagcctttctcatcaagtagccct
acgcctctcttcccctggttcacgtcgagtccccagacagagagaggcagaaacaaggac
agggcagcagaggaactctccaaagacaaagatgccgacaaaagcctggagaaggacaag
agcagagagaaagacagagagagagaaaaggagaacaaacgggagtcaaggaaagagaaa
aggagaaaagggtcagaaattcagagtagctctgctttgtttcctgtaggtaaaatgccc
aaagaaaaagttgtcagtgaagacgttgcagcatcatcatctgccaaaaaaactgctggg
cggaagaagtctacagcaatagatcccgcagcagacgggtccagtgctgctctggtagat
acggcagccatcaaaaccaaaacgtccaagaaaggtagaggggggttagacaaatcggat
ctggacctcagccccgctgtgccgtctttggagaaggaaaaagccctgcgtctttctgct
ccttcgtcaagcgccgttaaacattccgcttcctccatcagctctatgctggctcaagca
gacaaactgccaatgactgacaagagggtggccagtcttctgaaaaaggcaaaagcccag
ctgtacaagattgagaagagcaagtccctcaaacaagcggatcagccaaaagcacaggga
caagagagtgattcatcagaaacgtcagtccgaggaccacggataaaacatgtttgcagg
agggcagctgttgcgctgggccgcaagcgagcagtgtttcccgatgacatgcccactctg
agtgccttaccgtgggaagagcgggagaagatactgtcttccatggggaatgatgataag
tcatcgatagctggctcagaagaggctgaacctcttgctccacctatcaagccaattaag
ccggttaccagaaacaaggcacagcaggaacctccggtgaagaagggccgacgctcaagg
cgctgtgggcagtgttcgggctgtcaggttccagaggactgcggtgtctgtactaactgt
ctagacaaacccaagtttggtgggcgcaatataaagaagcagtgctgcaaaatgaggaaa
tgtcagaatctacagtggatgccttctaaagcatatctccagaagcaagctaaagctgca
aaaaagaaagagaagaaatcaaagacaaacgaaaagaaagaaagccattctggaaagaac
cagttggactctggacagaaacaaactcctcagactatcatatcgagagaagacaacgcc
gcaaagaagagcagtgaacccgcccgtaaacccgtggaggaaaagcatgaggatgggaat
tcctccgttccagtgtcggagcccaaacaggtccctgcatctggtaccagaaaggctggc
aagcaggcgtcccagccagtacagctccctccttctcagccaccaagctcaggacctttg
aaaaaagaagcacctaaacttaccacttctgagcctaagaaaaagcagactccccagcca
gaaataggcacagaacaaagcaaacagaaaaaaattgctccccgtccaactttccctgtg
aaacagaaaccaaaagaaaaggaaaagccccctcccataagcaagccagaaagcagcacg
ctgaatttgctcagcactctgactaacggaagcagttccaagcaaaagccacctacagat
ggagtccacagaatccgagtggatttcaaggaggactgtgaagtggagaatgtttgggag
atgggtgggttaggcatcgtcacctcggtacctattactcccagggtggtctgttttctc
tgtgccagcagtggacatgtggagtttgtgtattgtcaggtctgttgtgagcctttccac
aagttctgcttagaggagagcgagcggcccctggaggaccagctggaaaactggtgctgc
cgtcgctgcaagttctgccacgtgtgtgggagacagcaccaggccaccaagcagttgctg
gagtgtaacaagtgccgaaacagctatcaccctgagtgcctgggcccaaactacccaaca
aaacccaccaagaaaaagaaagtctggatatgtaccaaatgtgttcgctgcaagagctgt
ggatcaacgacaccaggcaaagggtgggacgcgcagtggtctcacgacttctcactgtgt
cacgattgtgccaaactctttgctaaaggaaatttttgtcctctctgtgacaaatgctat
gatgatgacgactacgagagcaagatgatgcagtgcgggaaatgcgaccgctgggtccac
tccaagtgtgaaaacctttctgatgaaatgtatgagatactctctaacttgcctgagagt
gtagcatacacctgcattaactgtacggagcagcatcccgcagagtggcgcctggcactg
gaaaaggagctgcaggtttccttaaagcaggttttgacagccctgttgaattctagaact
actagccacttgctgcggtaccgacaggcagcaaaaccgccggatttaaatcctgagacg
gaagagagtatcccatccagaagctctcctgaaggtcccgatcctcctgtcctaacggaa
gtcagtaaacaggaggagcagcaacctctggatctggaaggagtgaaacgaaaaatggat
caaggatgttacactgctgtgttggattttagtgatgatatcgtgaagataattcaagca
gccattaactctgatggagggcagccggaagttaagaaagccaatagcatggtcaagtcc
ttctttattcggcaaatggagcgtgtttttccctggttcagtgtaaaaaagtccagattt
tgggagccaaataaagtaacaagcaacagtggtatgttgccgaatgcagtgctgccccct
tcgcttgaccataattatgctcagtggcaggagcgtgaagagagcaaccgcactgaacaa
ccccctctgatgaagaaaatcattccagctccaaaacccaaagggcccggggagccagat
tcaccaactcctctacatcctcctacgccaccaatctctagctctgacagaagcagagag
gacagtcctgaacttaacccacctccggatgtagaagacaacaggcagtgcgcgttgtgc
ctgaaatacggtgatgacagtgctaacgatgctggacgtcttctctatattggccaaaat
gaatggacgcatgtgaactgtgctttatggtcagcagaagtatttgaagatgatgatggt
tctctgaagaatgtgcacatggctgtgatcaggggaaagcagctgagatgcgagttctgc
cagaagtcgggcgccacagtaggctgctgcctcacttcctgtacaagtaactatcatttc
atgtgctcgcgagccaagaactgcgtctttctggacgataagaaagtttattgccagagg
catcgtgacttgatcaaaggagaggtggttcctgagaacgggtttgaagttcttaggaga
gtttttgtggactttgaagggatcagtttgagaagaaaatttcttagtggcttggaacca
gagaatattcacatgatgattggttcgatgacaatagactgtttaggaattctgaatgac
ctctcagactgtgaagataagttgtttcccatcggctaccagtgctccagggtgtactgg
agcacaacagatgccaggaagcgctgtgtgtatacctgcaagatcatggagtgccgacct
ccggtcatagaacccgacatcaacagcactgtcgagcatgatgataacagaacaattgcc
catagcccagttccccttacagaaactctacctaaagacagccgaaatacacctgaaatt
gtaaacccaccgtcaccggaccgtcccttgcactctcagacctctagttcgtgttactat
ccagcagtctcaaagggtcccaggatccggacaccaagttacccatccacacagaggtct
cccggctccaggccgttaccctctgcaggaagtcctaccccagtgacccatgaaatagtg
acagtaggagatcctttactatcctctggacttaagagcattggttctaggagacacagc
acctcctctctgtcgcagcagcaatcaaaactccggatgatttcccctacgcgagcgggg
aacacgtattccaggcacagtgtcccttcggtttccggcatggggtcctcctcagaacac
gagccaagcatcaaaagtaccgaccgttttgtgggatcggtgaatgcaggtgcgcccagc
gctccagttcagagttgctctgccagttcaggctcccagaagacagcagctacaagcgga
agtaaaacttaccagctggacgcctctcagtctacagaaggaaaacattctagcagttcg
gattcgatagccaaaggtgcacctcttaagggagagaagatgaaaacggtgacctcaaag
gacccagattattcggctcacagttttgcttctggaggaaactccaaaatgtcgactcaa
ccaaccaccagttcatcaggcgcagaaatgaatgttaaaataggaacctttcaagaatgt
tcaggatcattttcttccaaagaagcaatatcctttccacctttgcatcagagaggcccg
aggaaggacagagatcagcacgtggaacctgtacagccagagaagacggctgtggttgat
gagatggatgtgaagaccttgaagtctgctggagtaaatagcagatctcccgcggcgagt
gagcaggtggtttctgcccctagagacaggcgtcagaaggggaaaaagttaatgaaagat
agttttaaagagaagcattccctgaaatctcttccagattctagtcaagcagtaggcagc
gatgaaggaaacctgaaaccagaatttggtaatcagggtttggcaactgaacaaactagc
cagaggttgtgtaataatattccggctgaaaaagccggcgagaagtctccaccttcacaa
ggggcatctaaaggttctgcagcacagatcgaagtggcccctaaggaatcgcaggcccct
agaaaacgcactgttaaagtcactctgactcctctcaagatggaaagcgaaaaccagtct
aaaaatgcgcagcaggaaggcgacgccgagcctcagtctgcaggagcagaactggccgct
ttggcagagccctcctcaacttcggaaagcccggaagataaccccgcagttcagggaagc
ccaaatgaggcaccagcgcaggaagctcagaataatgcctatgaaaatttgcccgttcaa
gataacaacttgatgctccaggatggaagtaaagctcaagaagaaggctcgtacaagcgg
aggtatccacggagaagtgctcgggccagatccaacatgttctttggattgactcctctg
tatggcgtgaggtcatacggagaggaagacattcccttctacagtaactcaactgggaag
aagcgagggaagcggtctgcagaaggacaagtggatggtgcggatgacttgagcacatca
gatgaagacgacttatactactataacttcacgagaacggtggtgtcctcaaacacggag
gagaggcttgcatcccataacttattcagggaggaggagcagtgtgatctcccgaaaatc
tcacagctagacggtgtggatgatggaactgaaagtgatacaagcgtcacggcaacaacg
agaaaagtcagtcaagtaaccaaaaggagcggtaaagaaaacggaacagagaacttaaag
ctagatagaactgaagaagccggagagaaagtgcaagtcaccaagagctccgctgtccac
aaaaccgacccaaagattgataactgccatcctgtgagcagggttaaagctcaaggtcag
gattccctggaagctcagctgagctcgctggaaacgggccgcagggctcacgcaagcacg
ccttctgacaagaacttactggacactttcaacacagaactcctgaaatccgactctgac
aacaacaacagcgacgactgtgggaacatcctcccttctgacatcatggactttgtacta
aagaacacgccatctatgcaggcattgggagaaagtccggagtcctcgtcgtccgaactt
ctaacgcttggagaaggtttaggtctcgacagcaaccgtggcaaggatatgggtttgttc
gaggtgttctctcagcagctgccaaccgccgagccnnnggatagcagcgtctcttcctcc
atatcggcagaggagcagtttgaattgccgctggagcttccttcagatctctctgttctg
accacccgcagccctacggtgcccagccaaaatcacaaccggcttgccgtcatctcagag
tcttcgctctcctcctcgggagagaggtcgatgcttgccttgccttccacggagtctggg
gaaaagagagtgacggtcacagaaaaatctgcctcgggggaaggcgatacagctctcctg
agtccaggagtagacccgagccccgaaggacacatgactcccgatcacttcatccagggt
cacatagatgcagagcacatagccagcccgccctgcggccccgtcgagcaagggcacggc
agcaaccaggatttaacgagaaatagcgggactccaggtatccaggtgccggtatcgccc
accgttcccctccagagccagaagtacgtgccgaactccacggacagtcctggcccctca
cagatctccaacgccgcggtgcagacaacgccgccccacctcaagccggctgcagagaaa
cttctggtagtcaatcaaaacatgcagccgctgtacgtcctccaaactcttcccaatggc
gttactcaaaagatacagttaacgccttctgttagttctgcgcagagcgtgatggagacc
aacacttcagtgctggggcccatggggagcgggctgacgctgaccacgggattaaatccg
agcttgccctcgtctcagtcattattccctcccacgagcaaggggctgctgcccatgtcc
catcaccagcacatgcatcccttctccacagccactcagaccggcttcccaccaaacatc
agtagtccttcaccaggtcttctgattggcgtgcagccgccccctgatcctcagctcttg
gtgtctgaagctagtcagaggacggaccttggtaccactgcttctacaccagctgctgtc
ctgggcaagaaacggcccatctctcgcctgcagtcacggaagaacaagaagctggctccc
tctggaaacccttctgctatagctcctcctgatatggtctccaacatgactttaattaat
tttgctccgtcccaaatttccaaccacccattggatttggggaccattgcgaattcaaca
tcccatagaaccgtccccaatattatcaaaaggtccaagtctggggtcatgtattttgag
cagacatctttgctcccacaaggtgggaccactactgcagtcggcacgtctcccagtgtt
atcgggccagatgccagtcacctcccagcggggcctgtgtcgggcctagcgtcgagctcc
tcggtgctgaacgtcgtctccatgcaggccgcagcagcccctactacgggtgggtcggtt
cctagtcatgttttgggacaaaattcagtaacgttaactagccctggattactaggggac
cttggttcaataagcaacctcctgatcaaagctagtcagcagagccttggtcttcaggag
cagcacgtgactttaccaccaagttctgggatgttttcgcaactgggagcatcccaaact
ccatctacggcagcgatgacggctgcatcgagcatatgtgttctgccttcagcacagacg
atgggcatgacagttgctccgtcgtctactgacccagaaggctcttaccagcttcagcac
atgacacaactcttagccagcaaaaccggggttgcttcctcccagctggacctcagcaca
gcttcggcaacgacgcagttgtcgagctttccgcagctggttgatgttcccaacagtacc
ggactcgaacaaaacaaggcttcctcgtcggtgatgcatgccagttcagcctctcctgga
ggctccccgtcatccggtcaccagtctgcaagtagctctgtgctgggtcccacgaaaatg
aagccgaaaatcaaacgcattcagccactgttagataaagggaatggaaagaagcacaaa
acttctcacgtgtggaccagttcctctgaagcgcacgttcccgacagaggggccactgct
gtaccccaggtctcagctacagggactcctgctatgaaggccgatacgcaggatgcggca
agcgtagatcagccatcgcagaaacaatgtggccagtccgcagggcaaacggcagccctc
ccagaatctcagtcaacacagaactcaacaaacgagcaagaaaatgcaggctccaaagct
cttgaggaagaagagagcacttttagctccccgctcatgttttggcttcaannacaaaag
agcaaagagtgtcttggtgagaagaaaccaaagaaaggtttggtttttgagatctctagt
gacgatggttttcaaatctgcgcagaaagcattgaagatgcctggaagtcactgaccgac
aaagttcaagaagcccgttccaacgcccgcctgaaacagctgtcttttgcaggtgtgaac
ggtttgaggatgctggggattatccacgataccgttgtgttcctgattgagcagctgtac
ggagcgaagcactgccacaactacaagttcagatttcataagccagaggaggccaatgaa
cctcctctgaatccacacggctctgctagggccgaagtccacctgaggaaatcggcattt
gatatgtttaatttcttggcttctaaacaccgccagccaccagaatacaacccgaatgac
gaggaagaggaagaaatacagctgaagtcagcccggagggcaactagtatggatctgcca
atgcccatgcgcttccgacacttgaagaagacctccaaggaggcagttggtgtctacagg
tctcccatccatggccggggtctgttctgcaaaaggaacatcgatgcaggtgagatggtg
atcgaatattcaggcaatgtcattcgctccatcctcactgacaaacgagagaaatactac
gacagtaaggggatcggttgctacatgttccgcattgacgactccgaagtggtggatgcc
accatgcacgggaacgcggcccgcttcatcaatcactcctgcgagcccaactgctactcc
cgggtcatcaacatcgatggccagaaacacatcgtcatcttcgccatgcgcaaaatctac
cgaggggaagagctcacgtacgactacaagttccccattgaagacgccagcaacaaactg
ccctgtaactgcggcgccaagaagtgcaggaagtttttaaactag

DBGET integrated database retrieval system