KEGG   Ethanoligenens harbinense: Ethha_0757Help
Entry
Ethha_0757        CDS       T01384                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00010  Glycolysis / Gluconeogenesis
eha00052  Galactose metabolism
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01120  Microbial metabolism in diverse environments
eha01130  Biosynthesis of antibiotics
Module
eha_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:eha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_0757
   00052 Galactose metabolism
    Ethha_0757
Enzymes [BR:eha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Ethha_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADU26326
UniProt: E6U2N5
LinkDB All DBs
Position
827716..828762
Genome map
AA seq 348 aa AA seqDB search
MPEPKRFGTTKDGREVRCFLLRNVSGMCVEILDYGGTVRSCKVPDKTGAIRDVVLGYDTV
EAYEAGSCYFGALIGRCANRIAGGRLRVDGQNYQLTRNDGPNHLHGGKNGLNRHLWEARQ
ISDSTLVLHAECPDGEDGYPGNLSVTVIYDLSDDGELSIDYHAVCDRDTVCNLTNHMYFN
LAGHDSGASIHGESIRIDADSYTETDAASIPTGAVLPVENTPMDLRAPVAIGAHIEDDFP
QLRQAGGYDHNWIVRGYDGRLKEMAFACDESSGIVLRVSTTLPGVQFYTGNFIPRHQGKD
GAWYGRRSAFCLESQYFPGLLEIPPYPSPFLSKGREYHQTTVYRFSLR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaccaaaacgattcggcacgaccaaagacgggcgggaagtccggtgctttttg
ctgcggaacgtttccggcatgtgtgtggaaattctggactatggcggaaccgtgcgttcc
tgcaaggtgccggataaaacgggcgcaatccgggatgtcgtgctgggctacgatacggtg
gaagcctatgaagccggttcctgctatttcggggcgctcattgggcgatgcgccaatcgt
atcgccggagggcggctccgggtggatggccaaaactatcagttgacgcggaacgacggt
cccaatcatttacatgggggcaaaaacggcttgaaccgtcacctttgggaggcacggcag
atttccgattccacgctggtgctgcacgccgaatgtccggatggagaagatgggtatccc
ggcaacctgtccgttaccgtgatctacgatctgtcggacgatggagagctgtccatcgat
taccacgccgtttgcgaccgggacacggtctgcaatcttaccaatcatatgtatttcaat
ctggcgggacatgacagcggcgccagcattcacggggagagcatccgtatcgacgccgat
tcctatacggagaccgacgctgcgagcatcccgaccggtgcggtcctgccggtggagaat
acccccatggacctgcgtgccccggttgccatcggggcgcatatcgaggatgatttcccg
cagttgcgtcaggccggcggatacgaccacaactggatcgtgcgcggatatgacgggcgc
ttaaaggaaatggcgttcgcctgcgatgaatcctccggcattgtgctccgtgtgtctacc
acattgccgggcgtgcagttttacaccggaaatttcattccgcgtcaccaggggaaagac
ggtgcgtggtacggcaggcgctccgcgttctgtttggaaagccagtattttcccgggttg
ttggaaattccgccttatccgtctccgtttttgtcgaaaggccgggagtatcaccagacg
acggtctatcgctttagcttacgataa

DBGET integrated database retrieval system