KEGG   Ethanoligenens harbinense: Ethha_1042Help
Entry
Ethha_1042        CDS       T01384                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00970  Aminoacyl-tRNA biosynthesis
eha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ethha_1042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eha03029]
    Ethha_1042
Enzymes [BR:eha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ethha_1042
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ethha_1042
Mitochondrial biogenesis [BR:eha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ethha_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADU26595
UniProt: E6U495
LinkDB All DBs
Position
1150161..1151615
Genome map
AA seq 484 aa AA seqDB search
MELYENTASGLHTLFVEKKASAVEIAEAHLARIEAVDERVGAFLTVTKEEALARAAEQDR
KLAAGEPLGALSGVPVAVKDNICTKGVRTTCASKMLHNFTPPYDATVADKLREAGAVMVG
KTNMDEFAMGSSCETSHFKKTHNPRDLECVPGGSSGGSAAAVAAGEVPLALGSDTGGSIR
QPAALCGVVGLKPTYGAVSRYGLVAFASSLDQIGPFARTADDTALLLDAIKGRDTHDATS
AHREQAPVAGTLDGNVKGLRIGIPQAYYGDGVDDAVKTQVLDTARALEQAGAALVDVSLS
STRYALPTYYILACAEASSNLARFDGVKYGYRTEHYDDLLSLYENSRSEGFGDEVKRRIM
LGTFVLSSGYYDAYYHKAKLTQNLIRGEYDAAFGACDVILTPTSPVTAFKIGERTADPLQ
MYAADICTVPVNIAGLPAVSLPCGEVDGLPVGLQFIGRKFEERTILNAAKAVEQICGTAV
PAAL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtatgaaaacacggcgtccggcctgcacacgctgtttgtggaaaagaaagcc
agcgccgtcgagatcgcagaagcgcatctggcacgcatcgaagcggtggatgagcgcgtg
ggcgcattccttaccgttaccaaagaggaagcgctggcccgcgctgccgagcaggaccgg
aagctggcggcgggcgaaccgctcggcgcgctctcgggcgtacccgtagccgtgaaagac
aatatctgcaccaaaggcgtgcgcacgacctgcgcgtccaaaatgcttcataacttcaca
ccgccttatgacgcgaccgtggcggacaagctgcgggaagcgggcgcggtgatggtcggc
aagaccaatatggacgagtttgccatgggttcctcctgtgaaacgtcccatttcaagaag
acacataacccgcgtgatctggaatgcgtgccgggggggtcctccggcggcagcgcggcg
gcggtggcggcgggcgaagtgccgcttgccctcggttcggataccggcggttccatccgc
cagcccgccgcgctttgcggcgtggtggggctcaagcccacctacggcgcggtttcacgc
tatgggctggtggcgtttgcttcttcgcttgaccagatcgggccgttcgcgcgcacggcg
gacgataccgcgctgctgcttgacgccatcaagggccgcgacacgcatgacgcgaccagc
gcgcaccgggagcaggcacctgtggccggcacgctggacggcaatgtgaaaggcctgcgc
atcggcatcccgcaggcgtattacggcgacggcgtggacgacgcggtgaagacccaggtg
ctcgacaccgccagagcgctggaacaggcgggcgccgcgctggtggatgtctcgttgtcc
tccaccagatatgcgttgcccacttattacatcctggcctgcgcggaagcgtcttccaac
cttgcgcggttcgacggcgtgaaatacggctaccgcaccgagcactacgacgacctgctt
tccctctatgaaaattcgcgctccgaggggttcggcgacgaggttaagcgccgcatcatg
ctcggtaccttcgtgcttagctccggctattacgacgcgtattaccacaaggccaagctg
acgcagaacctcatccgcggcgagtacgacgcggcgtttggcgcgtgcgacgtcatcctc
acgcccacctcaccggtcacggcgttcaaaatcggcgagcgcaccgccgacccgctccag
atgtacgcggccgatatctgcaccgtgccggtcaacatcgcggggctgccggccgtgtcg
ctgccctgcggggaagtggacgggctgccggtcggcctgcagttcatcgggcgcaaattc
gaggaacggacgattctgaacgcggcaaaagccgtggagcagatctgcggcacagccgtg
ccggccgcgctgtga

DBGET integrated database retrieval system