KEGG   Ethanoligenens harbinense: Ethha_1074Help
Entry
Ethha_1074        CDS       T01384                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
eha  Ethanoligenens harbinense
Brite
KEGG Orthology (KO) [BR:eha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eha03012]
    Ethha_1074
   03029 Mitochondrial biogenesis [BR:eha03029]
    Ethha_1074
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eha04147]
    Ethha_1074
Translation factors [BR:eha03012]
 Eukaryotic Type
  Elongation factors
   Ethha_1074
 Prokaryotic Type
   Ethha_1074
Mitochondrial biogenesis [BR:eha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Ethha_1074
Exosome [BR:eha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ethha_1074
  Exosomal proteins of breast cancer cells
   Ethha_1074
  Exosomal proteins of colorectal cancer cells
   Ethha_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADU26627
UniProt: E6U4J9
LinkDB All DBs
Position
1189004..1190206
Genome map
AA seq 400 aa AA seqDB search
MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKVLGLKGKAQFQAYDQIDKAPEERERG
ITINTAHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARNVGVPYIVVFLNKVDQVDDPELLDLVEMEVRELLSNYDFPGDDVPIIKGSALQVLE
STSTDPNAPEYKCISDLMDAVDEYIPTPERKSDLPFLMPVEDVFTITGRGTVATGRVERG
QVKVGEEVEIIGLTTERKKTTVTGLEMFRKTLDFAEAGDNVGALLRGVQRADIERGQVLC
KPGTIHPYTKFSGQVYVLTKEEGGRHTAFFNNYRPQFYFRTTDVTGVVTLPEGTEMCMPG
DNVTMDVELITPIAIEVGLRFSIREGGRTVGSGMVTAVKD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatatgagagaacaaaaccgcatgttaacattggtaccatcggtcac
gtcgaccatggcaaaaccacgctgactgctgccatcaccaaagtgctgggcttgaaaggc
aaggctcagttccaggcatacgatcagatcgataaagctccggaagagcgtgaacgcggc
atcaccatcaacaccgcgcacattgaatacgaaaccgaaaaacgtcactatgctcacgtt
gactgccccggccacgccgactatgtgaaaaacatgattaccggcgccgcgcagatggac
ggcgccatcctggttgtgtccgctgccgacggccctatgccgcagacccgcgagcacatt
ctgctggctcgtaacgtcggcgtgccgtatatcgttgtgttcctgaacaaagtcgaccag
gttgatgatccggaactgctcgatctggtcgagatggaagtgcgcgaactgctttccaac
tatgacttcccgggtgacgatgtgccaatcatcaaaggctccgctctgcaggttctggag
agcacttctaccgatccgaacgcgccggaatacaaatgcatttcggatctcatggatgcg
gtcgacgaatatatcccgaccccggagcgcaagagcgatctgccgttcctgatgccggtt
gaagatgtcttcaccatcaccggtcgcggcaccgtggccaccggtcgtgtggaacgcggc
caggtcaaagtcggcgaagaagtcgagatcatcggcttgaccaccgagcgtaaaaagacc
accgttaccggtttggaaatgttccgcaaaacgcttgattttgctgaagccggcgataac
gtgggtgccctgctccgcggcgtgcagcgtgcagacatcgaacgtggccaggttctctgc
aaacccggtacgatccatccgtataccaaattctctggccaggtctatgttctgaccaaa
gaagagggtggccgtcacaccgcgttcttcaataactatcgtccgcagttctacttccgg
accacggatgtgacgggtgttgtcacgctgccggaaggcactgaaatgtgcatgcctggc
gataatgtcaccatggacgtggaactgatcacgccgatcgccattgaagtgggcctgcgt
ttctccatccgtgaaggcggccgtacggtcggttccggcatggttaccgcagttaaagac
tga

DBGET integrated database retrieval system