KEGG   Ethanoligenens harbinense: Ethha_2097Help
Entry
Ethha_2097        CDS       T01384                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eha  Ethanoligenens harbinense
Brite
Enzymes [BR:eha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ethha_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADU27614
UniProt: E6U3L4
LinkDB All DBs
Position
complement(2246484..2246975)
Genome map
AA seq 163 aa AA seqDB search
MDTYPYLEVQAAAPRLPDVAVAMVAGGPAYAGLRGRVQFTQRPGGVAVDAHIHGLPKTPT
GFFAFHLHEGPCGNPGVNPADYFPQTGGHFNPGNTPHPFHAGDFPPLLETENGAAYLSFF
TSRFTVRQVIGRSVVIHLNPDDFTTQPSGNAGPKIACGVIAAR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggatacatacccctatctggaggtgcaggcggccgcgccccggctgcccgatgtggcc
gtggccatggtggcgggcgggccggcttatgcggggctgcgcggcagggtgcagtttacg
caacggcccggaggcgtggcggtggatgcgcacatccacggcctgccgaagacacctacc
ggatttttcgcgttccacctgcatgagggcccctgcggcaatcccggcgtcaacccggcg
gattatttcccgcagacgggcgggcatttcaatccgggcaacacgccgcatccgtttcat
gcgggtgattttccgccgctgctcgaaacggagaacggcgccgcctacctcagctttttc
accagccgtttcacggtgcggcaggtcatcggccggtcggtagtcatccacctgaacccg
gacgatttcaccacgcagccttcgggcaacgccgggccgaagatcgcctgcggggtgatc
gccgcgcggtaa

DBGET integrated database retrieval system