KEGG   Ehrlichia sp. HF: EHF_0071Help
Entry
EHF_0071          CDS       T03078                                 

Gene name
recJ
Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03410  Base excision repair
ehh03430  Mismatch repair
ehh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHF_0071 (recJ)
   03430 Mismatch repair
    EHF_0071 (recJ)
   03440 Homologous recombination
    EHF_0071 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0071 (recJ)
Enzymes [BR:ehh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EHF_0071 (recJ)
DNA repair and recombination proteins [BR:ehh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     EHF_0071 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHF_0071 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHF_0071 (recJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecJ_OB DHHA1 DHH
Motif
Other DBs
NCBI-ProteinID: AHX04221
UniProt: X5GJ79
LinkDB All DBs
Position
complement(67209..68738)
Genome map
AA seq 509 aa AA seqDB search
MDKAIQRICKAIYNKEKIVIFGDYDVDGATSSALIKQYLTQIGVSTTIYIPDRICEGYGP
NTQALLKLQKIGNSLCITVDCGTIAHEPILAAKLANLDVIVIDHHMGLNTLPDAIAVINP
NRLDENSPYTYLAGVGVSFLLLVALNKTLKERGFFTHNHEPNLMKYLDLVALGTVCDVMP
IVGLNRAFVKQGLKIMATRQNIGLKILSDIIGLEEKPNIYQLGFNIGPHINAGGRVGNAS
LGARLLSTNSEEEALEISEKLQNFNLERKELEHKSFKEAVEQVEALISANTNLIMVAGNW
HPGIIGIVAGQLKDKFFLPSIVISLDNGIGKASARSIPDVDLGAAILSAKLEGIITEGGG
HAMAAGFSVQEDKIKTLYEFLSQKFHNINKQKVFKVDGIITVTAINLILWKELQSLEPFG
IGNPEPRFILTNIKIKNPEIIGDSHIRCLIYDNKTFIKGICFRCVDTELGLALLERTAIM
LLGKISVNYWRGNENIQFIIEDAIIKSHV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcaatacaaagaatttgcaaagcaatatacaataaagaaaaaattgttatt
tttggagattatgatgttgatggagcaacatcatctgcattaataaagcaatacctgaca
caaataggtgtatctacaacaatatatattccagatcgtatatgtgaaggatatggacca
aatactcaagctttacttaaattgcaaaaaattggcaatagtttatgcataactgtagat
tgtggcactatagcacatgaaccaatattggcagcaaaattagcaaatcttgatgtgata
gttattgaccaccatatgggtctgaacactctaccagatgcaattgcagttattaatcct
aatcgcttagatgaaaattctccatatacatacttagcaggagttggtgtatcattttta
ctgcttgtagcactaaataaaactttaaaagaaagaggattcttcacacataatcatgag
ccaaacctaatgaaatatctagatttagtagcattgggaaccgtatgtgatgttatgcct
atcgtaggattaaacagagcttttgtaaaacaaggcttaaaaattatggcaacaagacaa
aatataggtctcaaaattttatccgatattattggattagaagaaaagccaaatatttat
caactaggatttaacatagggccacatattaatgctggaggaagagttggaaatgcaagt
ctcggtgcaagattattatcaaccaacagtgaagaagaagccctagaaatttcagaaaaa
ttacaaaatttcaatctagaaaggaaagaactagaacataaaagttttaaggaagcagtt
gaacaagtagaagctctgatatcagcaaatacaaatttaattatggttgcaggaaattgg
cacccaggaataataggtatagtagcaggacaacttaaagacaaattttttctaccaagc
atagtaatttcactagacaatggcattggtaaagcaagtgctagatcgataccagatgta
gacttaggtgcagccattttatcagcaaaattagaaggaataataactgaaggaggaggg
catgctatggctgctgggttctcagtacaggaagataaaattaaaacgttatatgaattt
ctttcacaaaaatttcacaatattaataaacaaaaagtatttaaagtagatggcattatt
actgtaacagcaattaatctaattttatggaaggaactacagtctttagaaccatttggt
ataggtaatcctgaaccaagattcattctgacaaacattaaaataaaaaatccagaaatt
ataggagatagtcacataagatgtttaatctatgacaataaaacctttataaagggaatt
tgttttagatgtgtagatacagaattaggcttagctttattagaacgcactgcaattatg
ttactaggaaaaattagtgttaactattggagaggtaatgagaacatacagtttataata
gaagacgcaattataaaaagtcatgtatga

DBGET integrated database retrieval system