KEGG   Ehrlichia sp. HF: EHF_0237Help
Entry
EHF_0237          CDS       T03078                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase family protein
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHF_0237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0237
Enzymes [BR:ehh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     EHF_0237
DNA repair and recombination proteins [BR:ehh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHF_0237
 Prokaryotic type
     EHF_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pur_DNA_glyco
Motif
Other DBs
NCBI-ProteinID: AHX04893
UniProt: X5GKB3
LinkDB All DBs
Position
complement(248135..248701)
Genome map
AA seq 188 aa AA seqDB search
MLKKSFYEQSSLNVASKLLGKRLLFNQHQGIIIETEAYIGQDDPAAHSAHGYTKRTSVMF
GSPGFSYIYFIYGMYHCLNVVTEPKGFPAAVLIRGIVLLSDHQPNTVISGPGKLCKILKI
TKEHNNIDITQNNNFCICNTDIDIDNYICTPRIGISKGKEKFWRFVIPDVTFLLSTEYQD
KKMNNSLT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaaagtctttttatgaacaatcatcactcaatgttgcaagcaagttacttggg
aaaaggctactattcaatcaacaccaaggaataataatagaaacagaagcatacataggt
caggatgacccagccgcacactctgcacatggatatacaaagcgtacttctgtaatgttt
ggcagcccagggttttcttacatttattttatttatggaatgtaccactgtcttaacgtt
gtaactgaaccaaaagggttccctgctgcagtacttattagaggaatagtactactatct
gatcatcaacctaacactgtaattagcggtccaggaaaattatgtaaaattcttaaaata
acaaaagaacataataatatagatattacacaaaataacaatttctgcatttgtaataca
gatattgatatagataactacatatgcactcccagaataggaataagcaaagggaaggaa
aaattctggcggtttgtaatcccagatgtaaccttcctactatctactgaatatcaagat
aaaaagatgaataatagtttaacataa

DBGET integrated database retrieval system