KEGG   Ehrlichia sp. HF: EHF_0600Help
Entry
EHF_0600          CDS       T03078                                 

Gene name
xth
Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHF_0600 (xth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0600 (xth)
Enzymes [BR:ehh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     EHF_0600 (xth)
DNA repair and recombination proteins [BR:ehh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     EHF_0600 (xth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos PAN_4
Motif
Other DBs
NCBI-ProteinID: AHX05027
UniProt: X5GD79
LinkDB All DBs
Position
complement(671633..672478)
Genome map
AA seq 281 aa AA seqDB search
MNLKIATWNVNSVRKRLDHLCSWLVEYDIDIALLQEIKCTNEQFPFSNVESLGYRCYVHG
QKARNGVAIITRYPIVGELVTSIFLSDYESSLCHKLSSEGFIYNYRESRYLECVILCNNV
KVCVASVYVPNGQSIDSDAFQYKLGFFDQLREHMFSLLKQEDILILGGDYNVGPYPIDVY
APEIMDGRLCFHKSEREKFRSILNLGFTDAFRILNEYEQKFTWWNYKAGAWQENKGLRID
HLLLSPQAVDKLLSCVIHDKLRGLDIPSDHAPVVCSIDLNS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaaatagctacgtggaatgttaattctgttaggaagaggttggatcatcta
tgtagttggctggtagagtatgatattgatatagcattattacaagaaataaagtgtaca
aatgaacaatttcctttttctaatgtggaatcattaggatataggtgttatgtacatgga
cagaaagctagaaatggggtagctattataacaaggtaccctatagttggggaattggtt
acaagtatttttttatctgattacgaatctagtttatgtcacaaattaagttcagaaggt
tttatttataattatagagaatctcgttatttagaatgtgtgattttatgtaataatgtt
aaagtttgtgttgctagtgtatatgttcctaatgggcaaagtattgattctgatgcgttt
caatataaacttggattttttgatcagttaagggaacatatgttctctttacttaaacag
gaagatattttaatattgggtggtgattataatgtagggccttatcctatagatgtgtat
gctcctgaaattatggatggtaggctgtgctttcataaatctgaaagagaaaaatttcga
tctattttaaatctaggatttacagatgcttttcggatattaaatgagtatgagcagaag
tttacttggtggaattataaagcaggtgcatggcaagaaaacaagggtttaaggatagat
catttattattatcaccacaagctgtagataagctgttatcttgtgttattcatgataaa
ctcagagggttagatataccttctgatcatgctccagttgtatgtagtattgatttaaat
tcttag

DBGET integrated database retrieval system