KEGG   Ehrlichia sp. HF: EHF_0712Help
Entry
EHF_0712          CDS       T03078                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh00061  Fatty acid biosynthesis
ehh00780  Biotin metabolism
ehh01100  Metabolic pathways
ehh01130  Biosynthesis of antibiotics
ehh01212  Fatty acid metabolism
Module
ehh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EHF_0712 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EHF_0712 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EHF_0712 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ehh01004]
    EHF_0712 (fabI)
Enzymes [BR:ehh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EHF_0712 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EHF_0712 (fabI)
Lipid biosynthesis proteins [BR:ehh01004]
 Fatty acid synthase
  Component type
   EHF_0712 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AHX05081
UniProt: X5GLR7
LinkDB All DBs
Position
complement(804771..805571)
Genome map
AA seq 266 aa AA seqDB search
MKGKKGLIIGIANDKSLAWGIAKTLAMHGADIAVTYLSDVFKKRIDPLVGSIGVKLVLQC
DVSKEDTVDSMFAQLSNEWESMDFLVHAVAFSDKNELKGRYIDTSLNNFLTSMHISCYSL
TYLAKKAEKLMCNGGSILTLSYYGAQKVMPHYNVMGVCKAALEASVKYLAVDLGSQNIRV
NAISAGPVRTLASSGIGDFHYILTWNKYNAPLRRNTTIEDVGGAALYLLSDLGKGTTGEI
LYVDGGYHAIGMKAIDAPDINYVEAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaaaaagggttaattattgggattgctaatgataaatctttagcctggggg
attgctaaaaccttagctatgcacggagcagatatagcagtgacttatttatctgatgtt
tttaaaaaaagaatagatcctttggtaggatctataggtgtgaagttagtgttgcaatgt
gatgtatctaaagaagatactgtagatagtatgtttgcacagcttagtaatgaatgggag
agtatggattttttagttcatgctgttgctttttctgataaaaatgagctgaaaggtagg
tatattgatacatcactgaataattttttgacgtctatgcatatatcatgttactcgctt
acttatcttgctaaaaaggcggaaaagcttatgtgtaatggaggtagtatattgacgtta
tcttattatggtgctcagaaagtaatgcctcactataacgtgatgggagtgtgtaaagca
gctttagaagcaagtgtaaagtatctggctgttgatttaggttctcagaatattagggtt
aatgctatttctgctgggccagtaagaactttagcatcttctggaataggagattttcat
tacatattaacgtggaataaatataatgcgcctttaaggcgtaatactacaatagaagac
gtaggtggagcagcactttatttattaagtgatttgggtaaaggtactacaggggaaatt
ttgtatgttgatggtgggtatcatgctataggtatgaaagcaatagatgctcctgatatt
aattatgttgaggctaaataa

DBGET integrated database retrieval system