KEGG   Ehrlichia sp. HF: EHF_0961Help
Entry
EHF_0961          CDS       T03078                                 

Gene name
polA
Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03030  DNA replication
ehh03410  Base excision repair
ehh03420  Nucleotide excision repair
ehh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHF_0961 (polA)
   03410 Base excision repair
    EHF_0961 (polA)
   03420 Nucleotide excision repair
    EHF_0961 (polA)
   03440 Homologous recombination
    EHF_0961 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ehh03032]
    EHF_0961 (polA)
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0961 (polA)
Enzymes [BR:ehh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHF_0961 (polA)
DNA replication proteins [BR:ehh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     EHF_0961 (polA)
DNA repair and recombination proteins [BR:ehh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     EHF_0961 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHF_0961 (polA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_5 ECSIT HHH_2 RTP1_C2
Motif
Other DBs
NCBI-ProteinID: AHX05092
UniProt: X5GDC9
LinkDB All DBs
Position
complement(1103866..1106445)
Genome map
AA seq 859 aa AA seqDB search
MRVFTIIDAYGLLFRAYYALPNLRTSYGLPIGGVYGFINIFLKYIEKHETDYLVVVFDTG
SKNFRHDIYPEYKSNRPKLPDDLISQFSLLRETVSAFNIASEEVVGYEADDVIATLGKKY
CKLQDIKVTVVTSDKDLLQLLKYGIYIFDPMKNKYIEEEDVRSKFGISSSQLLDFLSLTG
DASDNIPGVPGIGVKTAARLLNDFKSLDDLLLRAHEIKTNRCRESIVQYSSQAILSRKLV
TLYDKIDICEDIEKYVFQVSKIQELMEFFKKYELHSLESKVNKILKTSTSSTNQNSNDSS
DTMVNNKVIHYSAESFKVFVENCKSEGIMALHIEVTDNAIDSISLSYRKDVLLHIDKDHI
DNALGLIKSVLSLNYVLKVIYDVKTLLKIIPDVNIIAFDDIMIMSYVLNPSAHNHSLRNL
VSYNVKQDVTNIEATTLLLLHKLLKKELFANQLYTIYERIEKPLIHVLDSMEKTGILIDI
DILKTLSSTFSKNINMLENEIYRLSGTEFNIASSKQLGSILFDKMGIKKGKRLSSGSYST
DAEVLNDLVFNEIEIADKVLKWRHFTKLKGTYTDALGKQIDSNSGRIHTFYSMISTATGR
LSSSNPNLQNIPIRSEEGSAIRRAFVAKRGYKLISADYSQIELRIIAHIANVQAFKDAFS
LDQDIHSITARQIFGTQNLDKNLRRKAKSINFGIIYGMSAFGLAKQLGISKSEASAYIDN
YFKSYPEIQSYMDNIKIYAKTHGYTRTIFGRKCFVKDINSSNITARNFSERAAINAPLQG
TSADIIKMSMIHLFDRITNGSLILQVHDELLFEVLEEYVDYTVEVITEVMEGVIKLSVPL
KIDVSVGDNWADLVPYSKK
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttttacaattatagatgcttatggattactcttcagagcatactatgcttta
ccaaatcttagaacatcttatggattgcctattggtggagtttatggttttataaatatt
tttttaaagtatatagaaaaacatgaaactgattatttagttgttgtatttgatactggt
agtaagaattttcgtcatgatatatatccagaatataaaagcaatcgtcctaagcttcct
gatgacttaatatcgcaattttcattgttaagagaaaccgtcagtgcttttaacatagct
tctgaagaagtggtggggtatgaagcggatgatgtcatagcgactttgggtaaaaaatat
tgcaaattacaagatattaaagtgacagttgtaacatcggataaagatttattacaactt
ctaaaatacggtatttatatatttgatccgatgaaaaataaatacattgaggaagaggat
gtacgaagtaaatttggcatatcatcaagtcagttgttggatttcttatctttgacaggg
gatgcatcagataatatacctggggttccaggtattggagtcaaaacagcagcgaggctg
cttaatgattttaagtcattagatgatttgttattacgtgcacatgaaattaaaacaaat
aggtgtcgtgaatcaatagttcagtatagtagtcaggcgatattatctcgtaaattggta
actttgtatgataagatagatatatgtgaggatatagaaaaatatgtttttcaggtttct
aagatacaggaattaatggaatttttcaagaaatatgaattgcattctttagaaagcaaa
gttaataagattttaaaaacaagcacatcatctactaaccaaaattctaatgatagtagt
gatactatggttaataacaaggttatacactactctgctgagtcatttaaagtatttgtt
gaaaactgtaaaagtgaaggaataatggcgttacatatagaagtaaccgataatgctatt
gatagcatttctttatcctataggaaagacgttttgctccatattgataaagatcatata
gataatgcattagggcttattaaatcagtacttagtttaaattatgtgttaaaagtaata
tatgatgtaaagacattgttgaaaattattcctgatgtgaatattatagcttttgatgat
attatgataatgtcatatgttttaaatccaagtgcacataatcattcattacgaaatcta
gttagttataatgttaagcaagatgttactaacatagaagctacaactttattgttgttg
cataagctacttaagaaggagctatttgcaaatcaattgtatactatctatgaaaggatt
gagaaaccgttgattcatgtgttagatagcatggaaaagacgggtatattgattgatatt
gatattttaaaaacattgtcatctactttttcaaaaaacatcaatatgctagaaaatgaa
atatatagactttcaggaacagaatttaatattgcatcttcaaaacagttgggaagtatc
ttatttgataagatgggtataaagaaaggtaaaagattaagttcaggtagttatagtaca
gatgctgaagttttaaatgatcttgtatttaatgaaattgaaatagcggataaagtatta
aaatggcgtcattttacaaagttaaaaggtacttatactgatgctttggggaagcagata
gatagtaatagtgggagaatacatactttttactctatgatatcaactgctactggtagg
ttgagttcaagcaatccaaatttacagaatattccaattaggagtgaggaaggtagtgct
ataagaagagcgtttgttgcaaaaagaggatacaagctaatttctgctgattattcacaa
atagaactgcgaataatagcacatatagccaatgtacaggcatttaaagatgcattttct
ttagatcaagatatacattcaataacagcaagacagatatttgggacccaaaatttagat
aaaaacttaagaagaaaggcaaaatcaataaattttggtatcatttatggtatgagtgca
tttggtctagctaaacagcttggtatttctaagtccgaagcaagtgcatatattgataac
tattttaagtcatatccggaaattcaatcttatatggataatattaagatttatgcaaaa
actcatggttatactaggactatttttggtagaaaatgttttgtaaaagatattaatagc
agtaatattacggcgagaaatttctctgaaagggcagctattaatgctcctttgcaaggg
acatcagctgatataataaagatgtcaatgattcacttgtttgatagaattacaaatggt
tcacttatacttcaagtgcatgatgaattgctatttgaagttttagaagaatatgtagat
tacacagtagaagtcataacagaagtaatggaaggtgtgattaaattgtcagtaccatta
aaaattgatgtctctgtaggagataattgggctgatctagttccatatagtaaaaagtag

DBGET integrated database retrieval system