KEGG   Ehrlichia sp. HF: EHF_0965Help
Entry
EHF_0965          CDS       T03078                                 

Definition
(GenBank) uracil-DNA glycosylase, 4 family protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHF_0965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0965
Enzymes [BR:ehh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     EHF_0965
DNA repair and recombination proteins [BR:ehh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHF_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DELLA
Motif
Other DBs
NCBI-ProteinID: AHX04586
UniProt: X5GKD3
LinkDB All DBs
Position
complement(1110595..1111362)
Genome map
AA seq 255 aa AA seqDB search
MEVLKFYHESGVDCTLEDVECNTFANKNLSLQSSNSTGYGMEEKKASIKENTEGYYLLKA
QNLAEQCNTIEQLKSAIESFDGCDIKNLATNTVFADGNPKAKVMLIGEAPGANEDLKGIP
FCGASGVLLDKMLQAIGFDRTTVYISNAVFWRPPGNRRPTDFEIAVCKPFVEKHIALIMP
KILVLVGSTACYSMLDSKNPISKLRGRFHSYSNQFFQHSITTAIIFHPSYLLRQPMQKRI
AWEDLKQIKRYFDTL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtattaaagttttatcatgaaagtggtgttgattgtacgttagaagatgtagag
tgtaatacttttgcaaataaaaatctatctttacaaagtagtaatagtacaggatatggt
atggaagagaaaaaggcaagtattaaagaaaatacagaagggtactatttattaaaagct
caaaatcttgctgaacaatgcaataccatagagcagttgaaaagtgctatagaatctttt
gatggatgtgatataaaaaatttagcaacaaatactgtatttgctgatggaaatcctaaa
gcaaaagtaatgttaataggagaagctccgggagcgaatgaagatttaaaaggtatccca
ttttgtggtgctagtggtgtgctacttgataaaatgttacaggcaataggctttgacaga
actactgtgtatattagcaatgctgttttttggcgtccccctggtaatagaagaccaaca
gattttgaaatagcggtatgtaagccttttgtagaaaaacatatagctttgattatgcct
aaaatattagtattggttggaagtactgcatgttattctatgcttgattctaaaaatcct
atatctaaacttagagggagatttcattcatatagtaatcaattttttcagcatagtatt
actacagctattatatttcatccatcatacttattacgtcaaccaatgcagaaacgtatt
gcttgggaagatttaaaacaaattaagcgttattttgatactttataa

DBGET integrated database retrieval system