KEGG   Entamoeba histolytica: EHI_030400Help
Entry
EHI_030400        CDS       T00238                                 

Gene name
268.t00009
Definition
(RefSeq) protein kinase domain containing protein
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 3404117
NCBI-ProteinID: XP_649819
UniProt: C4M453 A0A5K1UYB2
LinkDB All DBs
AA seq 342 aa AA seqDB search
MGNSNSTLKLGNEKLLIKKILSTGRNSTTYLTEQSSSSTLPHNLVCKRFELTTSEMIGKI
TDEISLLSLCTRTPNIIQYYGYTQLTDSMLLFSEYCPYTIDDAFSLPIPEETIIEVFHGI
ASALAFLHSQKPSITYFNLRKEHVLLSEDYTVKLCDFGSAQLSETFYYRKPNDHQIIKEF
INNNVKPEYQSPEMILLYENQPISRKSDIWALGCLLFETAIGTPPFSAPLCISDVKQLDL
TDYQMSKRMKSLLKEMLVFDQNKRPNIYTILEHFSQVVEFNNPYKSFMKETDDDMGSTQS
SGIKTPSSLSQDSKQSLFWQLLDKKQIDCSVEKSVLDTFNEL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacagtaatagtacgttgaaattaggaaacgaaaaattattaattaagaaaata
ctttctacaggaaggaattcaacgacctatttgacagaacaaagttcatcatctaccctt
cctcataatttagtttgtaaaagatttgaacttactacatctgaaatgattggtaaaatt
actgatgaaatttcattattatctctttgtactagaacaccaaatatcattcaatactat
ggatatactcaattaactgattctatgcttttattttctgaatattgtccttatactata
gatgatgctttctctttaccaataccagaagaaacaattattgaagtatttcatggaatt
gcaagtgcacttgcttttcttcatagtcagaaaccatctattacatattttaaccttaga
aaagaacatgttttattatcagaagattatactgtaaaactatgtgactttggaagtgct
caactatcagagacattttattatagaaagccaaacgatcatcaaataatcaaagagttt
attaataataatgttaagcctgaatatcaatctccagaaatgatattattatatgaaaat
caaccaattagtagaaaaagtgatatctgggcacttggatgtttattgtttgagactgca
attggaacaccaccattctctgcaccactttgcatttctgatgtaaaacaattagattta
actgattaccaaatgtcaaaacgaatgaaatctttacttaaagaaatgcttgtttttgat
caaaataaacggcctaatatatacactatcctagaacattttagtcaagttgttgagttt
aataacccatataaatcatttatgaaagaaactgatgatgatatgggttcaactcagtca
tcaggaattaaaactccttcttcactatcacaagattctaaacaatctttattttggcaa
cttcttgataaaaaacaaattgattgctctgttgaaaagagtgtacttgatacttttaat
gaattatag

DBGET integrated database retrieval system