KEGG   Entamoeba histolytica: EHI_030750
Entry
EHI_030750        CDS       T00238                                 

Gene name
195.t00013
Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00620  Pyruvate metabolism
ehi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EHI_030750 (195.t00013)
Enzymes [BR:ehi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     EHI_030750 (195.t00013)
SSDB
Other DBs
NCBI-GeneID: 3405164
NCBI-ProteinID: XP_650862
UniProt: C4M1E4
LinkDB
AA seq 1153 aa
MFNQEQGTDYPVLNKKKLESLANLKLAMGGHEYPTDDLTQQGLKLAGPLLEEVEESEVNH
TTAPIDARLQTFLNSYFAECGEEVPKIPDDTFILDREGLGRVLSFPPHKQEFFCETMKSY
KIKQGVLHNPAKDKRTTVGVFHICQSDVPVPADKIECPKIAFLRMLKAAFYGAPDDHLII
PYTAECKEPTRSWVSLYMRPVVVPGVKGVKGFEHEKATEMHFFVPGNMVSCLDFVESVFG
NAGNPRLSKNDAALDPLGWTGHSGMAILAPHLTRMTKKECGLPHISQATERQKRERMCWE
KEDELYNDGKTFKMYCRDASGVICTIIADNYFGYCKKEVKTQISYSANLYGFAEEEHAGG
AVTRPSYDLGEACKAVQYAEGYKFSEMVEKNKHSIIVKEEGYAVDKKYPEGIIYVPEDSV
FTIEDASIKFNHNGKEESILLTPKVNYVLPNGYTIILHDTMTSRRWTLRGILPQYTLCHK
PCTVSGGGKSEISKSIRDAVIEGSVFVNNKEEDFKAVQEIFDHDFSKRYANGEVKPIHIL
DPNVTLGTVVELLTPSHLFTKEHNDYISSISPLIVELVMTIKSLYREDWKGDWQSRITVD
KINGNEGNELKYRGANLCSQYLRVGFERDETTWRVFQLRKDFFPAAKLQMEDDITASVIV
PTKLLKTPINNMQKKACKIVKNCELRLFQRPDDAVFRGFDKQTEYDFSIPGHFISNYQPM
TREEAKDFTKDVVRLYQYTEPMRKCLQDFVAGKDEAKYIVSSSYTRLVPEGDKLVGSKNP
RYLQRRPDMLDPEYTYMTFKAIQLYRKISDEEPLYTPVDAVLSGRRNNPPQVAKNGMKLR
PLSVFAPLHYFELPELLMECITSMTGASPSMFGAGSEGALTKGPFNSLPAVVDLNNYLLG
MICCGYSGFVSSASYCGPHYKVAHDISLLIPEIWSKMRRYEQEPKYLIEHGYLEPCPDVT
YNGKTYSGKRLGYRITTAFANHFLRTLFSMPNSVMPEDFLKPELQDLAIYADSYEYMSQT
DKGIAMNYVKDGTVEGACPPLKALIYIMANGEYNGMTRESKEFREMFDPEVVLNSEWYKE
RLVTRQKLEVAKLNKDLAYLNKTIAEKPRLVETLNKQIAAVKEELQYVSSEEYLIDIDGS
IGTDPYPYKCMKH
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgtttaatcaagaacaaggtactgattatcctgttttaaataaaaagaaattagagagt
cttgctaatcttaagttggctatgggtggacatgaatatccaactgatgatttgacacaa
caaggattaaaacttgctggtcctttattagaagaagtagaagaatctgaagttaatcat
actactgcaccaattgatgctagacttcaaacattccttaattcatattttgctgaatgt
ggagaagaagtaccaaaaattccagatgatacttttattcttgatagagaaggacttgga
agagtattatcattcccaccacataaacaagaatttttctgtgaaactatgaaatcatat
aaaattaaacaaggagtacttcataatccagctaaagataaaagaactactgttggtgtt
ttccatatttgtcaaagtgatgttccagttccagctgataaaattgaatgtccaaaaata
gcattcttaagaatgcttaaagcagcattttatggagcaccagatgatcatcttattatt
ccatatacagctgaatgtaaagaaccaactagatcatgggtttcactttatatgagacca
gttgttgttccaggagttaaaggagttaaaggatttgaacatgaaaaagctactgaaatg
catttctttgtaccaggaaatatggtgtcatgtcttgattttgtagagtcagtttttgga
aatgctggtaatccaagattatctaaaaatgatgctgctcttgatccacttggatggact
ggacatagtggaatggctattcttgcaccacatcttactcgtatgacaaagaaagaatgt
ggacttccacatattagtcaagctactgaaagacaaaaacgagaaagaatgtgttgggaa
aaagaagatgaattatataatgatggtaaaacattcaaaatgtattgtagagatgcatca
ggagttatttgtactattattgcagataattactttggatattgtaagaaagaagttaaa
acacaaatttcatattcagctaatttatatggatttgcagaagaagaacatgcaggagga
gctgttactagaccatcatatgatcttggagaagcatgtaaagctgttcaatatgcagaa
ggatataaatttagtgaaatggttgaaaagaataaacattccattattgttaaagaagaa
ggatatgctgtagataaaaaatatccagaaggaattatttatgttccagaagattcagta
tttacaattgaagatgcatcaattaaattcaatcataatggaaaagaagaaagtattctt
ttaacaccaaaagtaaattatgttttaccaaatggatatactattattttacatgataca
atgacatccagaagatggacattaagaggaattcttccacaatatactctttgtcataaa
ccatgtactgtttcaggaggaggaaaatcagaaatttcaaagagtattcgagacgctgtt
attgaaggaagtgtctttgttaataacaaagaagaagattttaaagcagttcaagaaatt
tttgatcatgatttctctaaaagatatgcaaatggagaagttaaaccaattcatattctt
gatccaaatgttactcttggaacagttgttgaattgttaacaccatcacacctctttact
aaggaacataatgattatatttcatctatctcaccattaattgtagaattagttatgact
attaaatctctttatagagaggattggaaaggagattggcaatcaagaattactgtagat
aaaattaatggaaatgaaggtaatgaattaaagtatagaggagctaacctttgttcacaa
tatcttagagttggatttgaaagagatgaaactacatggagagttttccaattaagaaaa
gatttcttcccagcagctaaattacaaatggaagatgatattacagcatcagttattgtt
ccaactaaattacttaaaacaccaattaataatatgcaaaagaaagcatgtaaaattgtt
aagaattgtgaattaagattattccaaagaccagatgatgcagttttcagaggatttgat
aaacaaactgaatatgatttctctattccaggacatttcatttctaattatcaaccaatg
actagagaagaagctaaagacttcactaaagatgttgtaagattgtatcaatacactgaa
ccaatgagaaaatgtttacaagactttgttgcaggtaaagatgaggctaaatatattgtt
tcatcatcatacactagattagttccagaaggagataaacttgttggatcaaagaatcca
agatatttacaaagaagaccagatatgttagatccagaatatacctacatgacatttaaa
gctattcaattatatagaaagattagtgatgaagaaccattatatactccagttgatgct
gttctttcaggaagaagaaacaacccaccacaagtagccaaaaatggtatgaaattaaga
ccattatcagtttttgcaccattacactattttgaattaccagaattattaatggaatgt
attacttctatgacaggagcatctccatcaatgtttggagcaggatcagaaggagcatta
actaaaggaccattcaattcacttccagctgtagttgatttgaataattatcttcttgga
atgatttgttgtggatattcaggatttgtttcatcagcatcatattgtggaccacattat
aaagttgcacatgatatttcattattaattccagaaatttggtcaaagatgagaagatat
gaacaagaaccaaaatatttgattgaacatggatatcttgaaccatgtcctgatgttact
tataatggaaaaacatattcaggaaaaagacttggatatagaattactactgcatttgct
aatcatttcttgagaacattattctctatgccaaattctgttatgccagaagatttcctt
aaacctgaattacaagatttagctatttatgcagattcatatgaatatatgtcacaaact
gataaaggaattgctatgaattatgttaaagatggaactgttgaaggagcatgtccacca
ttaaaagcacttatttacattatggcaaatggtgaatataatggaatgacacgagaatct
aaagaatttagagaaatgtttgatccagaagttgttcttaatagtgaatggtataaagaa
agattagttacaagacaaaaacttgaagttgctaaattaaataaagacttagcttatttg
aataagacaattgctgaaaaaccaagattagttgaaacacttaataaacaaattgctgct
gttaaagaagaacttcaatatgtctcaagtgaagaatatcttattgatattgacggatct
attggaactgatccatatccatacaaatgcatgaaacattaa

DBGET integrated database retrieval system