KEGG   Entamoeba histolytica: EHI_052770Help
Entry
EHI_052770        CDS       T00238                                 

Gene name
154.t00005
Definition
(RefSeq) glucosidase II alpha subunit
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00052  Galactose metabolism
ehi00500  Starch and sucrose metabolism
ehi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EHI_052770 (154.t00005)
   00500 Starch and sucrose metabolism
    EHI_052770 (154.t00005)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     EHI_052770 (154.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 3405941
NCBI-ProteinID: XP_651633
UniProt: C4M3R6
LinkDB All DBs
AA seq 842 aa AA seqDB search
MFLFFSIIAFVIAIPNKPPTCSSRSWCNLNRFRPVSHYNADVRSYRYTNNILSFKLKPTW
SINKNIQLNIISLGDNQLYIRYTYPSIEHVRFNIPTNTAYKPLKPQEITLISSSAQVANF
KAGTTLFSVYKNASVIIDNDLCIGCTGQFLYREDTKSDYYPVGIDVEFPTKRLFGSGKNV
HQPLPLTDKSKGAFTEPYHFYASGYTTFPVNSTHPQYGNLPVFISHKGGKSTAVLYTNPT
DTFIDHELYNNKAKLLITSEDSDLSFFIISKSSPQELFKSYYSLTGVSFMPPRFSLGFHN
SKWGYNSQNIVEGVDNDADKYEFMYDALWLDIEHTQRKRYFTWGSSFPHPLKLQEQLKSK
NRYLVTIQDCHIASDNGYYVHDEGKQGNYFIKKGINNTDDYTGECWPLKSNWVDFLSEEA
RNWWAGLYSFDKYKDTTEIVYAWNDMNEPTEFDVQDLLVKKEAVHKGGILHKNVHNLYGM
LQQMSTQKGLLERTNNKYRPFVLTRSYYIGSQKYGAMWTGDSDATWEYLSSQVSQLVNIN
MLGFLCGGDVGGFAHNPSTELLIRWYQAGALQPFFRQHSSQTASRREPWLFEQSVSDRLK
YAVNLRYQMLPYWYSLWYYHRVDYKPVIRAMYYSFPESDDLFDNENQYMIGDALLASPVI
QEGETNHQVQIPKGKWYDYFNNSNVYNGPMNLVIPVTLDSIPLFGRGGYIITERMVTKGR
KSGTESEKNDYLRVVIYDNMGRAEGKFYTDDGISVDNSDNYVAVTMTMNNYSFDYTVQGD
YLYGEFINEFVLVTEKKFTKAFIIRDGEETELKFTQENGRLVITDFNNHFSSQWTHWSIR
FE
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgttccttttcttctctattattgcttttgtcattgcaatacctaataaacctcctact
tgttctagtaggtcatggtgtaatttaaataggtttagacctgtttctcattataacgca
gatgtacgttcatatagatataccaataatattttatcattcaaactaaagccaacttgg
agtataaataagaacattcaattaaatatcatttcattaggtgataatcagttgtatatt
agatatacttatccatctattgaacacgttagatttaatattccaacaaatactgcttat
aaacctcttaaaccacaagaaattacattaatatcttctagtgctcaagtagctaatttc
aaagctggaacaactttattttcagtttataaaaatgcatcagttataattgataatgat
ttgtgcattggatgtactggacaattcctttatagagaagatactaaaagtgattattat
ccagtcggaattgatgtagaatttccaactaaaagattatttggatctggtaagaatgta
catcaaccacttcctttaacagataagtctaaaggagcttttactgagccatatcatttt
tatgcttctggatatactacattccctgttaattctactcacccacaatatggtaattta
cctgtctttatatctcataaaggaggtaaatcaactgcagtattatatacaaatccaaca
gatacatttattgaccatgaactctataacaataaggctaaattacttattacttcagaa
gatagtgatctttctttctttattatttcaaaatcaagtccacaagagttatttaagagc
tattattcattaactggtgtttcttttatgccaccaagattttctcttggattccataat
agtaaatggggttataattcccaaaatattgttgaaggtgttgataatgatgctgataaa
tatgaatttatgtatgacgctttatggcttgatattgagcacacacaacgtaaacgatat
ttcacttggggatcatctttcccacatcctttaaaattacaagaacaattaaaatcaaag
aatagatatcttgttacaattcaagattgtcatatcgcatcagacaatggttattatgtt
catgatgaaggtaaacaaggaaattatttcattaagaaaggtattaataatactgatgat
tatacaggtgagtgttggcctttaaaatctaattgggtagatttcttatcagaagaagct
agaaattggtgggctggattatactcatttgataaatacaaagacacaactgaaatagtt
tatgcatggaatgatatgaatgaaccaactgaatttgatgtacaagatttattagttaag
aaagaagcagttcataagggaggtattcttcataaaaatgtacataacctttatggtatg
ttacaacaaatgtctacccaaaaaggattattagagagaacaaacaataagtatagacca
tttgttttaacaagatcatattatattggttcacaaaagtatggtgctatgtggactgga
gattctgatgctacttgggaatatttgtctagtcaagttagtcaattagttaatattaat
atgcttggatttttatgtggtggagatgttggaggatttgctcataacccatccactgaa
ttattaattcgttggtatcaagctggtgcattacaaccattcttcagacaacattctagt
caaacagctagtagaagagagccatggctatttgaacaaagtgttagtgatagactaaaa
tatgctgttaatttaagatatcaaatgttaccgtattggtattctttgtggtattatcat
agagttgattataaaccagtaattagagcaatgtattattcattcccagaatcagatgat
ttatttgataatgagaatcaatacatgattggtgacgctttattagcatcaccagtaatt
caagaaggagaaacaaatcatcaagtacaaattcctaaaggtaaatggtacgattacttt
aataatagtaatgtatataatggaccaatgaatttagtaattccagttactttggactct
atcccattatttggaagaggaggttatatcattactgagagaatggttactaagggaaga
aaatctggaacagaatctgaaaagaatgattatcttcgagttgttatttatgataatatg
ggacgtgctgaaggtaaattctatactgatgatggtattagtgttgataactctgataat
tatgttgctgttactatgactatgaataactattcatttgattacactgttcaaggagat
tatttgtatggtgagtttattaatgaatttgttttagttactgagaaaaagtttaccaaa
gcatttattataagagatggtgaagaaactgaacttaaatttactcaagaaaatggtaga
ttggttattactgattttaacaaccacttcagttcccaatggactcattggtctattcgt
ttcgaataa

DBGET integrated database retrieval system