KEGG   Entamoeba histolytica: EHI_068160Help
Entry
EHI_068160        CDS       T00238                                 

Gene name
150.t00013
Definition
(RefSeq) tyrosine kinase
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 3406032
NCBI-ProteinID: XP_651730
UniProt: C4LU09
LinkDB All DBs
AA seq 2171 aa AA seqDB search
MNRVMLVLVLCIYLTFAQCYKDGTVTIKNIDSCKTPSQGIGDVALEQRDGVEDYNGFSWT
RILLKTGSKTPILNIYDSSNERFLLQYDNREIITTTVNFYLQSSNCQWALYNNGRLLNPL
NFYFYPEFEISDSKPFIFAPHGEGTFVNKNSNYITIEFDYWDYNKARVSGKIRLFIVSRY
QSNYVGHVLTTTDSNVIMRPNYPNQVMCTLKNGAKRFGYNGGDKNEVKEDCTCTSVDGKW
DKDDCTEFLQYFQVVVDCEYTTSINEHYGGYAFKGCKENQLPIVTIPESSTVILEDMKIK
ENGVHFEVSGKLTISLTIPSSYPQILLNEVGSGTITVSSVTVESDIPFDQLLFISNSDSI
TAIGLTGYCSGGSYRRYAKEGSNEEVMCDCHFNENISGDYYIEVDCEKDSEYRNLILPTT
REITASRTWKSLVTQSIFDISGKYKLKAGSMTITCSGTIKTPVEVTTLTSNKKNGIVFFG
ELTVTTINTDITNDVVLLSSSSNVGSLSKSCDGKINGSSRFYTGTDPKCNCEYSKNSFKQ
RDCYLLPKYQELYFSLVTSSYKSIRKEYYSNIISTSSFSLSGSETLTIQSCDFSSLKSVT
IESSLYCKVMNVAKTTKIKVSALITIEMYNIPSEKYINDGAIISVTSPEYLLIKTVSGNV
CSDIASSTKPFNSDTYKAVQGCTLLSNNKLLRYCPTSNTEDTVKCSMKGSDYTTSSSFDK
EYCPCESANCYIYPTTTSIDLKLKSMENNFVIGGTSLTKEITNLKTITALIITSDSKNIN
ILSTETAHFQSLIVDGKSNTISLGHSSSLISINKISVNSEHNQVSVYAQSISSIYSKTTN
IIHIISPNDVNVNSMTYGTTTFNSVTSKDILISNEGSEISLTSEAKINSISTDAVTLQFN
SKVIINSINPTAKGVLIKLYKSESEIKLSTGTYLYTVYCPSAINIKIGMESKTPISLESY
GTVEFTSSTITLDTVNSGPSSNLIIGSDVTTFTLNKIITKKTYGEIFTLSPSTNQLTINL
APDYSSSITNPMILFYTRARRVNVDKQCDGVAVLSGSYSDEITTCKTLGLYNRECKLTDS
GYIYNGFIDYSCPCSSTKSNCEISLFSSHSTYQYPTGLQPTTLILESDTALTSINNVMFI
LQTNLYSLTLSGNNSVVSISSSDISSILLTVTSLENGFILHSQIKSMTINTKALLKSTSK
SYELLLGETTSLCDYYLFKEGYALCQKCKEGYILINNACYISTDIQHCTNYVKTTSEIKC
RECSYGYYWKDGSCSKCSESNCIVCKDNDGTCIECTEGYKLINGVCTAVTPEITSCLYFK
EYCYKCSNSLSVLFGSANYCGGCDSKCSNCKVTTDQCITCNINKKYMSVSGECSLIQTAD
LVSNNNIISCKSNYYLTSGECVSCSKKFKDCSICTEKTCITCSSPNAYITKDGSCEVDQN
CKIYENNQCSVCKDGYFKTSEGVCSSCTTGCNKCKDSSLCLECSDSYYLTTMGKCVANEL
PNCELSSKKGCTRCFDHFYLDSNGNCQECNKTCLTCFKNASFCTSCQSDYYLDQNTCITD
NGKSGKCSHILPGGKCAICKVGYYNLNSDCYECSENCTTCQRDANSCIECGENYYHSSSQ
NKCLSQDDLVYCISKNSWGCSKCLDGTYMYNGECYLCSDNCMNCIWSNICSSCDYGKVLR
NGKCIPLEAVVNCIETSNGKCSKCSLNYKPTELGDYCEFHLNVLIVILPIIGFIIILIVI
LCMAIILINSITRYTANKQREKEFTSFKMSSSSIHFVPLSNGSCLTTSMSEINFTENNVI
PVGQETKTLLCIGNTNKAIMKVQITNKTDCESKYGIRSEPQLAFIKPGNAVEFNLFVKPY
CTCKVDDPILIVSSDVKKSKEKTYQLHVIFETELSTRLDPDDIKEEKKIGEGTFGIVYLG
IFRGNKVAIKKMKQIDKNENKMTEFEKEVMMLDKFRSDYIIHFYGAVFIPNKICMVTEYA
EYGSLQDVLIKKTENEIPMSLRLKFMIDSAKGIEYLHSNGILHRDIKPDNILIVSLDNGI
EVNCKLTDFGASRNINMMMTNMTFTKGIGSPKYMAPEVLNREHYKMPSDIYSFAVTMLQC
FTWEDPFPKTQFKFAWDIADLVANGKRTNQIERVTNPQIKNLIVRSWEQDTRKRLNINDI
LSGLKTIDIAN
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtgttatgcttgtcttagtactatgcatatacttaacttttgcacaatgttat
aaagatggaacagtcacaataaaaaatatagattcatgtaaaacaccaagtcaaggtatt
ggagatgtagctcttgaacaaagagatggtgttgaagattataatggatttagttggaca
cgaattttattgaaaacaggttcaaaaacaccaatacttaatatttatgattcatcaaat
gaaagatttttacttcaatatgataatcgtgaaattattacaacaacagtgaatttctat
cttcaatctagtaattgtcaatgggcactttataataatggtaggttattgaatcctttg
aatttttacttttatcctgaatttgaaatatctgactctaaaccatttatttttgctcct
catggagaaggaacttttgttaataaaaattctaattatatcacaattgaatttgactat
tgggactataacaaagcacgtgtttcagggaagattagattgtttatcgtttcacgttat
caatcaaattatgtaggtcatgttttgacaacaacagactcaaatgtaattatgagacca
aattatccaaaccaagttatgtgcacattaaagaatggagcaaaaagatttggatacaat
ggtggagataagaatgaggttaaagaagattgtacatgtacatcagttgatggaaaatgg
gataaagatgattgcacagagtttttacagtatttccaagttgttgttgattgtgagtat
acaacatctataaatgaacattatggaggatatgctttcaaaggatgtaaagaaaatcaa
ttaccaattgttactattcctgaatcatcaacagtaatattagaagatatgaaaattaaa
gagaatggtgttcattttgaagttagtggaaaattaactatcagtttaactattccatca
agttatccacaaattttactcaacgaagttgggtctggaacaatcacagttagtagtgtt
actgtagaaagtgatattccatttgaccagttattatttataagtaacagtgatagtatt
actgctattggtttaacaggatattgtagtggaggatcgtatagacgatatgctaaagaa
ggttctaacgaagaagtgatgtgtgactgccatttcaatgagaatatttcaggtgattat
tacattgaagttgattgtgaaaaagattctgagtatagaaatttaatattgcctacaaca
cgtgaaattactgcatctcgaacatggaagtcattggtaactcagtcaatatttgacatt
tcaggtaaatacaagttaaaagctggttcaatgacaataacttgttcaggaactattaaa
acaccagtagaagttacaacacttacaagtaataaaaagaatggaatagtgttttttgga
gaattgacagtaacaacaataaacactgatattacaaatgacgttgtattactttcatca
tcaagtaatgttggttcattatcaaaaagttgtgatggaaagattaatgggtcaagtagg
ttctacactggaacagatccaaaatgtaattgtgaatattctaaaaattctttcaaacaa
agagattgttatctgttacctaaatatcaagaattatacttttctttggttacttcaagt
tataaatcaataagaaaagagtattattcaaatattatatctacttcatcattctcattg
agtggttctgaaacattaactatccagagttgtgatttttcatcattaaagagtgtcaca
attgaatcttctttgtactgtaaagtaatgaatgttgcaaaaacaacaaaaataaaagtt
tctgcactaatcacaattgaaatgtacaatatcccatcagaaaagtatatcaacgatggt
gctattatcagtgttacttctccagagtatttattaattaaaacagtttctggaaatgta
tgttctgacattgcctcatccacaaaaccattcaattcagacacgtataaagcagtacaa
ggatgtactttattgtcaaacaacaaactattaagatattgccctacttctaatactgaa
gacactgtcaaatgttctatgaaaggttctgactatacaacatcttcttctttcgacaaa
gaatattgtccatgcgaatcagctaattgctacatatatccaacaacaacatctattgat
ttaaaattaaaatcaatggaaaacaactttgttattggaggtacttctcttacaaaagaa
ataactaatctaaaaaccatcaccgctttaattattacatcagactcaaaaaatattaat
attttatcaacggaaacagctcattttcagtcattaattgttgatggaaaaagtaatacc
atttcactcggtcattcatctagtttaattagtataaataaaattagtgttaattctgaa
cataatcaagtcagtgtatatgctcaatcaatttcttcaatatattctaaaacaacaaac
ataattcatattattagcccaaatgatgttaatgttaattctatgacatatggaacaaca
acattcaattctgtaacaagcaaagacatacttatatccaatgaagggtctgaaatttca
ttgacttccgaggctaaaataaattctattagtacagatgctgtgactttacaattcaat
tctaaagtgataattaactcaataaacccaacagcaaaaggagttttaatcaaattatat
aaaagtgaaagtgaaattaagttatctacaggaacatacttatacactgtctattgtcct
tcagcaataaacattaaaataggaatggaaagtaaaaccccaatttcacttgaatcttat
ggaacagttgaatttacatcatcaacaatcacccttgatacagttaattcaggaccttca
tcaaatctcatcattggaagtgatgtcacaacattcaccctcaataaaattataaccaaa
aaaacatatggagagatatttacattatctccttcaacaaatcaactcactattaacctt
gcaccagactatagttctagtattactaacccaatgatcttattctatactagagctcga
agggttaatgttgataaacagtgtgatggagttgcagtcctttcaggaagttattctgac
gaaattacaacatgtaaaacacttgggctgtataacagagagtgtaaactgactgattca
ggttatatctacaatggtttcattgattactcatgtccatgttcatctacaaaatcaaat
tgtgaaatatcattattttcatctcattctacttaccaatatcctactggactccaacca
accacattaatactagaaagtgacacagcactaacatcaataaacaacgttatgtttatt
cttcaaacaaatttatattcattaacactctcaggaaataattcagtagtttcaataagt
tcttctgatatttcttctattctattaacagttacttcattagagaatggatttattctt
cattcacaaataaagtcaatgacaattaatacaaaagcattattgaaatcaacaagtaag
agttatgagttacttttaggagaaactacttcattatgtgattattatttattcaaagaa
ggatatgccctttgtcagaaatgtaaagaaggatatattcttattaacaacgcttgctat
atatctacagatattcaacattgtacaaattatgttaaaacaacatctgaaataaaatgt
cgagaatgttcatatggttattattggaaggatggaagttgttctaaatgttctgaaagt
aattgtattgtttgtaaagataatgatggtacatgcattgaatgtaccgaaggatataag
ctaataaatggtgtgtgcactgctgtcactcctgaaattacaagctgcctttatttcaaa
gaatattgttataaatgttctaattctctatcagtgttatttgggtctgctaattattgt
gggggatgtgacagtaaatgttcaaattgtaaagttactactgaccaatgtattacatgt
aacataaataaaaaatatatgtcagtatcaggagagtgttctctcattcagacagccgat
ttagtttctaataacaacattatttcatgtaaatctaactattatttaacttctggagaa
tgtgtgtcttgttcaaagaaatttaaagattgcagtatatgcactgaaaaaacatgcatt
acttgctcttctcccaatgcatatattactaaagatggatcatgtgaagtagatcagaat
tgtaaaatatatgaaaataaccaatgttctgtttgtaaagatggatatttcaaaacatca
gaaggagtttgctctagctgtacaactggttgtaataaatgtaaagattctagtctttgt
cttgaatgtagtgactcatattatctaacaaccatgggaaaatgtgtagccaatgaatta
ccaaattgtgaacttagttccaaaaaaggatgtactcgttgttttgatcacttttatctt
gactcaaatggaaattgtcaagaatgcaataaaacatgtctaacatgttttaaaaatgcc
tctttttgtacttcatgccaatcagactattacttggatcaaaatacatgtattactgat
aatggtaaatctggtaaatgctcacacatattaccaggaggtaaatgtgctatttgcaaa
gttggttattataacttaaatagtgattgctatgaatgttcagaaaactgtaccacatgt
cagcgagatgctaatagttgtattgaatgtggagaaaattattatcattcatcatcacaa
aataaatgtttatcacaagatgaccttgtttattgtatttcaaaaaattcatggggttgt
tctaaatgtcttgacggaacatacatgtacaatggtgagtgttatttatgttcagataat
tgtatgaattgtatatggtcaaatatttgtagctcttgtgactatgggaaagtattgaga
aatggaaagtgtataccattagaagctgttgttaattgtatagaaacatcaaatggtaaa
tgctctaaatgttcattaaattataaaccaaccgaacttggagattattgtgaatttcac
ttaaatgttttaattgttattcttccaattattggatttattattattttaattgtcatt
ctttgtatggctattattctcattaattctattactagatacactgcaaataaacaacga
gaaaaagaatttacttcattcaaaatgtctagttcatcaattcattttgttccattatca
aatggaagctgtttgacaacaagtatgagcgaaataaactttactgaaaataatgtaatt
cctgtaggacaagaaactaaaacattattatgtattggaaatacaaataaagctataatg
aaagtacaaattactaataaaactgattgtgaaagtaaatatggaataagaagtgagcca
caacttgcttttataaaaccaggaaatgcagtagagtttaatttatttgtcaagccatat
tgtacttgtaaagttgatgatcctattcttattgtttcttcagatgttaaaaagagtaaa
gaaaaaacgtatcaacttcatgtaatatttgaaacagaactatcaacacggcttgaccca
gatgatattaaagaagaaaagaaaataggagaaggaacatttggaatagtatatcttgga
atattcagaggaaataaagtagcaattaaaaaaatgaaacagattgataaaaatgaaaat
aaaatgacagaatttgagaaagaagtgatgatgttagataagtttagaagtgactatatc
attcatttttatggagcagtatttattcctaataaaatatgtatggtaacagaatatgca
gaatatgggtcactacaagatgtgttaattaaaaaaactgaaaatgaaataccaatgagt
ctaagattgaaatttatgatagattctgcaaaaggaattgagtaccttcattcaaatgga
atattacatcgagatattaaaccagataatattcttattgtatcacttgataatggtatt
gaagttaattgtaaattaacagactttggagcatccagaaatattaatatgatgatgaca
aatatgacatttaccaaaggaataggatcaccaaaatatatggcacctgaagtattaaat
cgagaacattataaaatgccatcagacatatactcttttgcagtcacaatgttacaatgt
tttacatgggaagatccatttcctaaaacacaattcaaatttgcttgggacatagctgat
ttagtagctaatggaaaaagaacaaatcaaattgaaagagtaacaaatccacaaattaaa
aacttgattgttagaagttgggaacaagatacaagaaaaagacttaatattaatgatatt
ttaagtggattaaaaactatagacattgcaaattaa

DBGET integrated database retrieval system