KEGG   Entamoeba histolytica: EHI_073490Help
Entry
EHI_073490        CDS       T00238                                 

Gene name
9.t00051
Definition
(RefSeq) protein kinase
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo FHA Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 3410970
NCBI-ProteinID: XP_656675
UniProt: A0A5K1VAV0 C4LXL3
LinkDB All DBs
AA seq 396 aa AA seqDB search
MNEHLYSLIIFNGNEEIGRITIKKEQFVYGRNEVEFLRKYIWISRQHFQIEIKGEKEKKE
YVLTVKTNVITFHNNKQIKRDTEIFINSLDVISIPIPKTSIRQNILFISKDFEEKEMCCC
FYTKYQIIKFIGSGSFGKVFQIKRKSNNKINAVKIIDITQKKKSEIAQRESEVLEQIHHQ
NIIKKYETIQSQRFMYIIMEYIEGLTLEQYLQLKQHHTFNENEIKIIIKQVFNAINYLHS
NKIIHRDLKLENIMIRGKTNEEYKKLNIVVMDFGLGKILETKEYTLTKCGTSNYTSPQIL
QSGPYDGFKTDIWCCGVMLFYMSIGMFPFNQEGVNSSLMLRVNIRNGKICHQKEFNMISL
ELQDLIKNMLIVDEQKRFTIQQCLNHEFVSLKHQKT
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacatttgtatagtcttattatctttaatggaaatgaagaaataggaagaata
acaattaaaaaagaacaatttgtttatggaagaaatgaagttgaatttctaagaaaatat
atttggattagtagacaacattttcaaatagaaattaaaggagaaaaagagaaaaaagaa
tatgtgttaacagtaaaaacaaatgtaattacatttcataataataaacaaataaaaaga
gatacagagatattcattaattcattagatgttatttctattccaattccaaaaacatca
ataagacaaaacattctttttatttcaaaagatttcgaagaaaaagaaatgtgttgttgt
ttttatacaaaatatcaaattataaaatttattggaagtggctcttttggaaaagtattt
caaattaaaagaaagagtaataataaaataaatgcagtaaaaataattgatataactcag
aaaaagaagtctgaaattgcacaacgagaaagtgaagtacttgaacaaattcatcaccaa
aatattataaaaaaatatgaaacaatacaatcacaaagatttatgtatattattatggag
tatattgaaggattaactttagaacaataccttcaattaaaacaacatcatacttttaat
gaaaatgaaattaaaataattattaaacaagtatttaatgcaattaactatcttcattct
aataaaataatacatagagatttaaaacttgaaaatataatgattcgtggtaaaactaat
gaagaatataagaaacttaatattgttgtaatggattttggattaggaaaaatattagaa
acaaaagaatatactctaactaagtgtggaacaagtaattacacttctccacaaatactt
caaagtggaccttatgatggatttaaaacagacatttggtgttgtggggtaatgttattt
tatatgtctattggaatgttcccttttaatcaagaaggagtaaattcatcattaatgttg
agagttaatattagaaatggtaaaatttgtcatcaaaaagagtttaatatgatttcatta
gaattacaagacctcattaaaaacatgttaatagtggatgaacaaaaaagatttacaatt
caacaatgtttaaatcatgaatttgtttctctcaaacatcaaaaaacttaa

DBGET integrated database retrieval system