KEGG   Entamoeba histolytica: EHI_078170Help
Entry
EHI_078170        CDS       T00238                                 

Gene name
137.t00015
Definition
(RefSeq) protein kinase domain containing protein
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_8 LRR_4 Myotub-related
Motif
Other DBs
NCBI-GeneID: 3406303
NCBI-ProteinID: XP_651994
UniProt: A0A5K1UCP2 C4M543
LinkDB All DBs
AA seq 1894 aa AA seqDB search
MSAQVNKHIKGITKVDNRTSHKSKSTCTFNEQTRNATSCCLFVKTKENETEGEQCTIEGI
PLFVEHSFRFFELSSKIEKEVPPVPLQYLTYDTALLWASENMSKNFVDLVKMYKMDGNAI
SRLKMQDLRKYKFRIVECDTVLKKIKAYFHITNFGKRLLKNQGIDDSDLRQMYKYIDNHH
NGKLIPFNSMDKKQASTVAFLIIRNYLCSFDEIISETSFGEMIKFYHDHMRDDDDSFVRS
FDKVLQTCLTPLQYNVLIRTLRFMLVIMNSRGSVFVHFQDVFKKTMFSLISPISLDMDFT
FLLIFYSLKSRKPTNYIKMNLFQLNNKLLYGEYIIKQFDDILISDKTYTFHKQMNDVSTK
EWERGRIYITNFRVWWVPNDEECFQRNTRLLLLSYIPIRSIMEMKSFDSKEDITKEKKVC
VRMYDNLLRLFLFAFQSIQQLQDFRDELQMASVFEDNYPIDDVECISYEIPFKNYGEKKI
NRNGIHINSNEFKVFKEEENEYVIPYQLNNVDENKELPNIRGCIFLYKHSNGCTICRLSL
SKTVDKTKSFFLSTIDEVQKKYHAIYLSPQEKNDSMILKTSDEVNIIWNKIVDSAKKFTE
TTNFKEITTIFDEYIKYISIVFNNVFSLFVKVKLGESIMLQTRRDNETELPLYSSLIQFI
TDKYYWTYNGFVELIFVEFIQSNYFFFCNNGEICPIPHSFLIFIRIISLFVMTIPSAFEF
SQQLLNYLELICMSGRLRFNESRSQRSIVRLLVMKNKLKNQRYNSSTNVSLIDMYNENLF
SVQSLVLLFLKWMNVGKNCNFPLNPSIQNLDLQNKGIIALPVQENLKECHQLTQLNISQN
HLITIPSQITELSQLKDLNISTCSIYYIPYNCFSQLTNLTSLDISETSAINSELIKFPSF
SFLTKLEYLDISNHCKASGESIYLELPCSLRTFIAKQSLQTLPDLSKLKCLEKLDISDNR
QLKLNALAEVSSLRTFICRNRTTSTFPQQLFSIKLRYLDLSCDKIERLPQAFYNCITLES
LNLSNNQISTLSSQLSMLKNLKTLLIDNNPLTSKITLKPIPNSIPMSYPCYVHVFCTKGF
YSIFKKMIKMNKKSNFEFVSEISANSTKPQLILNFVDVEKTVIPYGMANDDLYIIHQEVK
DQAGLITHHILSNEKKYYFIGEKKMCCLLKKRKCKRSGTIGSDVEIIDAGPSMVDKLVSS
INSELNYKKEIRRIGMELYQTQYEEVTLTTKQMIQLVKFYNSNCDQTTLDELSNIGVIFD
LKKTEEGISECVKKGSESCPKGRYILRQVFDKKKNLVEKELSSFRPLREYFERLNKMTSD
DIINICRILQTHNALFMIYPNWINEMGITAESEKVIEKLKIPVEQPKRNKLNWKVGASGT
NKRCSLAETGSLSKRRSESLSPDEGGERLASKKDIFPVVLHPSIIKMKENAWPLHSKNEM
EIMREFVLGKPCYLMYMQLIGYLLLIGMELYDKIYNDATILKDERYSTTFLIKIQYCDGR
ISISIRYNTSSVSQVKISADIMQSIKKAINTIAVASNNTLEEYVGCTECILKDEKKIDVV
PVKEIKEARKEGKTEILFNKQHSVMIGTCALDILLNEMENSSIVPLFESKDMDIKEMKGF
GGSAKVNRVIVSHKEEMAFKMYTFNNYDKVSLKIGLGSTAHLVALKVEEMMKELEVLKLT
RGSSIRHTKYILQLHGICLEPLGILVDYMGEGTLQNYIGIKSNELPMTMVLRFAKNINNA
LDVLHSRNIIHRDVKSPNVLLKFNQQHQLIAVLSDFGLSGPYDENEHCMVENPLWLPPEV
LNTHHFLTASDIYAYGIILWEMITREKPFVGCKFMSEIANKIRAGERPQFKPNILIDNSL
KELIEMCWLEDPSKRPCCSQIKKVLQKVSKNLPH
NT seq 5685 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacaagtgaataaacatatcaaaggaattactaaagtcgataataggacgtct
cataaaagtaaaagtacatgtacatttaatgaacaaacaagaaatgctactagttgttgt
ttatttgtaaaaacaaaagaaaatgaaacagaaggggaacaatgtacgattgaaggaatt
cctttgtttgttgaacattcatttcgattttttgaattatcaagtaaaatagaaaaagaa
gttccacctgttccattacaatatttaacttatgacactgcgttattatgggcatcagaa
aatatgtcaaagaattttgttgatttagttaagatgtataaaatggatggaaatgctatt
tcacgattaaaaatgcaggatctaagaaaatataaattcagaattgtagaatgtgatact
gtcttaaagaaaattaaagcgtatttccatataactaattttggaaaaaggttattaaaa
aatcaaggaattgatgacagtgatttacgtcaaatgtataaatatattgataatcaccat
aatggtaaattgataccatttaattcaatggataaaaaacaagcttctactgtagcattt
ttaattattaggaattatttatgttcatttgatgaaattatatcagaaacatcatttgga
gaaatgatcaaattttatcatgatcatatgagggatgatgatgattcatttgttagatca
tttgataaagtacttcagacttgtcttactccattacaatataatgttttaataagaact
cttagatttatgttagtaataatgaatagtagaggaagtgtatttgttcattttcaagat
gtatttaagaagactatgttttcattaattagtcctatatcattagatatggattttaca
tttttattaatattttattcattgaaatcacgtaaaccaacaaattatattaaaatgaat
ttatttcaattaaataataaactactttatggagaatatattattaaacaatttgatgac
attcttatatcagataaaacttatacatttcataaacaaatgaatgatgtttcaacaaaa
gaatgggaacgtggacgtatttatataactaattttcgtgtttggtgggttccaaatgat
gaagaatgttttcaaagaaatacaagactgctattattatcatatattccaataagaagt
attatggaaatgaaatcatttgatagtaaagaagatattacaaaagagaaaaaagtatgt
gtaagaatgtatgataatcttttacgattatttctatttgcatttcaaagtatacaacaa
ttacaagactttagagatgaattacaaatggctagcgtatttgaagataattatccaatt
gatgatgtggaatgtatttcatatgaaataccatttaaaaattatggagaaaaaaagata
aatagaaatggaattcatatcaattcaaatgaatttaaagtatttaaagaagaagaaaat
gaatatgttattccatatcaattaaataatgttgatgaaaataaagaactacctaatatt
agaggatgtatatttttatataaacattctaatggttgtacaatttgtagattaagttta
tcaaaaactgtagataaaacaaaatcatttttcttatcaacaatagatgaagttcaaaaa
aaatatcatgcgatctatcttagtccacaagaaaagaatgattcaatgatacttaaaaca
agtgatgaagttaatattatttggaataaaattgttgatagtgcaaagaaatttactgaa
acaactaattttaaagaaataactacaatatttgatgaatatattaaatatatatcaatt
gtctttaataatgttttctctttatttgttaaagttaaacttggagaatctattatgctt
caaacaagaagagataatgaaacagaattaccattatattcttcattaattcaatttatt
acagataaatattattggacttataatgggtttgtagaattaatatttgttgaatttata
caaagtaattatttctttttttgtaataatggagaaatttgtcctattcctcattctttt
ttaatatttattagaattatttcattatttgttatgactattccatctgcatttgaattt
tcacaacaacttcttaattatttagaacttatttgtatgtcaggaagattaagatttaat
gaatcacgttcacaaagatcaattgttagattattagttatgaaaaataaattaaaaaat
caacgctataactcttcaacaaatgtcagtcttatagatatgtataatgagaatttattt
agtgtacaaagtttagtattattatttcttaaatggatgaatgttggaaaaaattgtaat
tttcctttaaatccttctattcaaaatcttgatttacaaaataaaggaattattgcttta
cctgtccaagaaaatttaaaagaatgtcatcaattaactcaattaaacataagccaaaat
catcttattacaattccttcacaaattactgaattatcacaattaaaagatttaaatata
tcaacttgttctatatattatattccttataattgtttctctcaattaactaatttaaca
tcattagatatctctgaaacatcagctattaattctgaattaatcaaatttccttcattt
tcatttcttactaaattagaatatcttgatatttctaatcattgtaaagcatcaggtgaa
tcaatatatcttgaattaccttgctctttacgtacattcattgcaaaacaaagtcttcaa
acacttcctgatttatctaaattaaaatgtttagaaaaattagatatcagtgataacaga
caattaaagttaaatgctttagctgaagtatcctcattaagaacttttatttgtaggaac
agaactacttcaacatttccacaacaactattttcaattaaacttcgataccttgattta
tcttgtgataaaattgaacgattaccacaagcgttttataactgcattacattagagagt
cttaatttatcaaacaatcaaatatcaactttatctagtcaattatcaatgttaaaaaat
ttaaagacattacttattgataataatccattaacaagtaaaatcactttaaaaccaatt
cctaatagtattccaatgtcatatccatgttatgttcatgtattttgtacaaaagggttt
tattcaatatttaagaaaatgattaaaatgaataagaaaagtaattttgaatttgtctca
gaaataagtgctaattcaacaaaaccacagttgatattaaattttgttgatgtagaaaaa
actgttattccatacggtatggctaatgatgatttgtatattattcatcaagaagtaaaa
gaccaagctggattaataactcatcatatattgtcaaatgaaaagaaatactatttcatt
ggagagaaaaaaatgtgttgtttattaaagaaaagaaagtgtaagagaagtgggactatt
ggtagtgacgtagaaattatagatgctggaccttcaatggttgataaattagttagttct
attaattcagaacttaattataaaaaagaaattagacgtattggaatggaattataccaa
acccaatatgaagaagttacattgaccactaaacaaatgattcaattggttaagttttat
aacagcaattgtgaccaaacaacattagatgaactaagtaatattggagtaatttttgat
ttaaagaagactgaagaaggaattagtgaatgtgttaaaaaaggttcagagtcttgtcca
aaaggaagatatattttaagacaagtatttgataaaaagaagaaccttgtggaaaaagag
ttatctagtttcagaccattaagagagtattttgaaagattaaataaaatgacgagtgac
gatattattaatatttgtagaatattgcaaacacataatgcattgtttatgatttatcct
aattggattaatgaaatgggaattactgctgaatcagagaaagttattgaaaaattaaaa
atccctgttgaacagcctaaaaggaataaattaaattggaaagttggagcatcaggaact
aacaaaaggtgttcattagcagaaacaggatctttaagtaaaagaagaagtgaatcttta
tctcctgatgaaggaggagaacgattggcatcaaaaaaagatatttttccagttgtacta
catccatcaattattaaaatgaaagaaaatgcatggcctttacattcaaaaaatgaaatg
gaaattatgagagaatttgttttaggtaagccatgctatttaatgtatatgcaattaatt
gggtatttacttcttattggaatggagttatatgataaaatatataacgatgcaacaata
ttaaaagatgaacgatattcaactacctttttaattaaaatacaatattgtgatggaaga
attagtatcagtattagatataatacaagctctgttagtcaagttaagatatctgctgat
ataatgcaatcaataaaaaaggctatcaacactattgctgtagcatcaaataatactttg
gaagaatatgttggatgtactgaatgtattttaaaagatgaaaagaaaattgatgtggtt
cctgtcaaagaaattaaagaagcaaggaaagaaggaaaaacagaaatattattcaataaa
caacactcagttatgattgggacttgtgcattggatattcttttaaatgaaatggaaaat
agttctattgtacctttatttgaatctaaagatatggatattaaagaaatgaaagggttt
ggaggaagtgctaaagttaatagagtcatagttagtcataaagaagaaatggcatttaaa
atgtatacatttaataattatgataaagtatcattaaaaattggattaggatcaactgca
catcttgttgctttaaaagttgaagaaatgatgaaagaattagaggtattaaaattaaca
agaggaagttctattagacatactaaatatattctacaactacatggaatttgtttagag
cctttaggaatacttgttgattatatgggagaaggcacattacaaaactatattggaatt
aaaagtaatgaattaccaatgactatggttttaagatttgctaaaaatattaataatgcg
ttagacgttctacattcaagaaatattattcatcgagatgttaaaagtcctaacgttctt
ctcaaatttaatcaacaacatcaattaattgctgtacttagtgactttggactttctggt
ccttatgatgaaaatgaacattgtatggttgaaaatccgttatggcttccaccagaagta
cttaatactcatcattttcttacagcatcagatatttatgcttatggaattattttatgg
gaaatgattactagagaaaagccttttgttggttgtaagtttatgtctgaaattgcaaat
aaaattcgagcaggagaaagaccacaatttaaaccaaatattcttattgataattcttta
aaagaattaattgaaatgtgttggttagaagacccttcgaaaagaccttgttgttctcaa
attaagaaagtactacaaaaagtttctaaaaatctaccgcattaa

DBGET integrated database retrieval system