KEGG   Entamoeba histolytica: EHI_125820Help
Entry
EHI_125820        CDS       T00238                                 

Gene name
11.t00002
Definition
(RefSeq) PH-protein kinase domain containing protein
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH PH_11 PH_8 Kinase-like PH_3 Pkinase_fungal PH_9
Motif
Other DBs
NCBI-GeneID: 3410836
NCBI-ProteinID: XP_656496
UniProt: C4LVW8
LinkDB All DBs
AA seq 441 aa AA seqDB search
MPKEGWLAKQGGGWKNWKHRWFVLDGTTLTYYKDQLRMKKMGEIDLMLAFAIVPNEELKL
KNFPYIFSISTPSRVYNISASSSKERDEWIESLLNSKNKKETLIEKEEEEKPISIEDFDI
ITLLGKGAFGKVLLVRYKRTGEKFALKMVEKKKVIEMEELEHTMTEKNILQKVKHPFLVN
LYYSFQSATHLHYVIDYCPGGELYYRLIQEKSFCESRTQFYISQVILALECLHQMNIIYR
DVKLENVLICEDGYLRLTDFGLSKENVSGNETTATFCGTPEYLSPEVVLAEPYTNVIDWW
GVGIMTYEMMHGQAPFISDNIQQLYQKILYSPVIFPTTSPVSAVCKDFITKMLEKKICDR
LSTPEKIKTHPWWNSFDWDALYQKKIPAPFKPDMSQDGKTNFGEEFINEKFDLNEEINNS
TSNGIRQDIFGEFTFTRDEPK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaaggatggctagcaaaacaaggaggtggatggaaaaactggaaacatcgt
tggtttgtgttagatggaaccacattaacatattataaagatcaattaagaatgaaaaag
atgggagaaattgatttaatgttagcatttgctatagttccaaatgaagaattaaaatta
aaaaattttccatatatattttcaataagtacaccttctagagtttataatatttcagcg
tcatcatcaaaagaaagagatgaatggattgaatcattattaaattcaaaaaataaaaaa
gaaacattaatagaaaaagaagaagaagaaaaaccaattagtatagaagattttgatata
attacgttattaggaaaaggagcatttggaaaagtgttattagtaagatataaaagaaca
ggagaaaaattcgcattaaaaatggttgaaaaaaagaaagttattgaaatggaagaatta
gaacatacaatgacagaaaaaaatatcttacaaaaagtaaaacacccatttttagtgaat
ttatattattcatttcaatcagctactcatttacattatgttattgattattgtcctgga
ggagaattatattatcgtttaattcaagaaaaatcattttgtgaaagtagaacacaattt
tatattagtcaagttattttagcattagaatgtcttcatcaaatgaatataatttataga
gacgttaaattagaaaatgtattaatttgtgaagatggatatcttagacttacagatttt
ggtttatctaaagaaaacgtttctggaaatgaaacaacagctacattttgtggtactcct
gaatatctctctcctgaagttgttttagcagagccttatactaatgtaattgactggtgg
ggagtaggaattatgacatatgaaatgatgcatggacaagcaccatttattagcgataat
atccaacaactttatcaaaaaattttatattctcctgtaatctttccaacaacatctcca
gtttctgctgtatgtaaagattttataactaaaatgttagaaaaaaaaatttgtgatcgt
ttaagtacaccagagaagattaaaacacatccatggtggaacagtttcgactgggatgct
ctttatcaaaagaaaattcctgccccatttaaaccagatatgtcacaagatggaaaaaca
aactttggagaagaatttattaatgaaaaattcgaccttaatgaagaaataaacaattct
acttctaatggcataagacaagacatttttggagaattcactttcactagagatgaacca
aaataa

DBGET integrated database retrieval system