KEGG   Entamoeba histolytica: EHI_138750Help
Entry
EHI_138750        CDS       T00238                                 

Gene name
243.t00003
Definition
(RefSeq) tyrosine kinase
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Cadherin_C_2 EphA2_TM YajC DUF2207
Motif
Other DBs
NCBI-GeneID: 3404435
NCBI-ProteinID: XP_650137
UniProt: C4M4I1 A0A5K1V2L5
LinkDB All DBs
AA seq 1088 aa AA seqDB search
MIIFLIFASLSNGSFQCKTNEYWSQNEGVCKSCSQQCLTCWSDTKCTSCREGYYLNENYG
CAQREAGLQEVCKTWDGLYCVECKEGYYIEQMKCNSCNVKNCEKCTKDKCFKCKEGYMLY
EIIGSDGKEKQECIDCTNEENDDKCGKCPLGKYFDIETFSCKECRDGCERCTTKDNCYLC
KGDKALKDPTDPNSECVSILHCTSGNYYGNQCELCEENYFVQKGMCVKCSDGCKRCINEK
ECIECNSTLSLINGECKNDINCLRSSNTMGCVECKEGYYLGNEGECKQCPVQCKLCKSDS
YCFRCNDNYYFTDVSNGICNKLNNRICNVGDQYGCLQCKYDVPYNESLDKTDALKFNVPI
DTSFKLGYYLPYSITSKREISYEPTCKMCNITCRICDKNPNWCTGCNAGYSLEKDTEATI
KYFEDFGVYNDIYKCVKMPSICKKTEMGYCVQCDDKYFLQGVDCKVCDESCDTCLSDKSC
QTCNSTIDPKTGNALWWRRPSESSLDTQSLCYSTSNLTHSSLSNCSDKITTSGCISCHSR
FYLNDGECLPCPTECYECELKNNITRCTKCSPNTQYLSKEDNKCLECSTIEHCLECNEKG
CTKCEDGYSETSDRLLCKKVRLGLIISLIVIGLLFIVIIICFIIFLIWRRRRKIIKEREK
EIKPFKVSGGVEMALLSADNANFPLKTDKWKLTFEHAGSKVIVDNLYEETIKIINPTKKT
YFFELLLGASHRYELSVEPMRFTLKPDYAVELKFKIKMICTAVVNDEIGIIAMDLDEEIK
ETAKISIIIESDLSTKLDHTELKLQMPAIGEGAFGMVFIGSYRGQKVAVKKMKARTLTEE
QEKEFKHEVNMLTQYRHPCIVNLVGAVYTEGEISIVTEFADYGSLSKLYKKELLPFDLKI
KIMEDIVVGLAFLHENNIIHRDVKGENVLIYSLNPHSQVCGKLTDFGTCRNISERALQLQ
PLSHGIGTPTYMAPECLANSNYSYSADVYSFAIILYETFTEQQAYIDDERFIQPWTIPQF
VIEGHRLEKPNDIPENYWNLINQCWTQDPEDRLTFNQIHHILINWNLDICNTELSTNKKD
PSLDSLSN
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgataatatttttaatatttgcaagcttatcaaatggaagtttccaatgtaaaacgaat
gagtattggagtcaaaatgaaggagtttgtaaaagttgtagtcaacaatgtttaacatgt
tggagtgatacgaaatgtacttcatgtagagaaggatattatcttaatgagaattatgga
tgtgcacaaagagaagctggtcttcaagaggtatgtaaaacatgggatggattatattgt
gtagaatgtaaagaaggatattatatagaacaaatgaaatgtaattcatgtaatgtaaag
aattgtgagaaatgtacaaaagataaatgttttaaatgtaaagaaggatatatgctttat
gaaataataggaagtgatggaaaagagaaacaagaatgtattgattgtacaaatgaagaa
aatgatgataaatgtggtaaatgtccattaggaaaatattttgacattgaaacattttca
tgtaaagaatgtagagatggttgtgagagatgtactacaaaagataattgttatctttgt
aaaggggataaagcattaaaagatccaacagatccaaatagtgaatgtgtttcaatttta
cattgtacatcaggaaattattatggaaatcaatgtgaactttgtgaagaaaattatttt
gttcaaaaaggaatgtgtgttaaatgtagtgatggatgtaaaagatgtataaatgaaaaa
gaatgtattgaatgtaatagtacattatcattaattaatggagaatgtaaaaatgatata
aattgtttacgttcaagtaatacaatgggatgtgttgaatgtaaagaaggttattattta
ggaaatgaaggtgaatgtaaacaatgtccagttcaatgtaaattatgtaaatcagattca
tattgttttagatgtaatgataattattattttactgatgtttctaatggtatttgtaat
aaattaaataatagaatttgtaatgttggtgatcaatatggttgtttacaatgtaaatat
gatgttccatataatgaatcattagataaaactgatgcattaaaatttaatgtaccaatt
gatacttcttttaaattaggatattatttaccttattcaattacatcaaaacgagaaatt
agttatgaaccaacatgtaaaatgtgtaatattacttgtcgtatttgtgataaaaatcca
aattggtgtactggatgtaatgctggatattctcttgaaaaagatactgaagcaacaata
aaatattttgaagattttggtgtttataatgatatttataaatgtgttaaaatgcctagt
atttgcaaaaaaactgaaatgggatattgtgttcaatgtgatgataaatattttcttcaa
ggtgttgattgtaaagtttgtgatgaatcttgtgatacttgtttatctgacaaatcttgt
caaacatgtaactccactattgatcctaaaacaggtaatgcattatggtggagacgtcct
tcagaaagttctttagatacccaaagtttatgttattctactagcaatctaacacattct
tcattatcaaattgttcagataaaataactacatctggttgtatatcatgtcattctcgt
ttttatttaaatgatggagaatgtcttccatgtccaacagaatgttatgaatgtgaatta
aaaaataatattacaagatgtactaaatgtagtccaaatacacaatatttgtctaaagaa
gataataaatgtcttgaatgtagtactatagaacattgtttagaatgtaacgaaaaagga
tgtaccaaatgtgaagatggatattcagaaacatctgatagacttttatgtaagaaagta
aggcttggtttaatcatctcattaatagttattggtcttctttttattgtcattattatt
tgttttatcatctttttaatttggagaagacgtagaaaaattattaaagaaagagaaaaa
gagattaaaccatttaaagtaagtggtggtgtggaaatggctcttctttcagctgataat
gctaatttcccattaaaaacagataaatggaaactaacatttgaacatgcaggatcaaaa
gttattgttgataatttatatgaagaaactattaaaataataaacccaacaaagaaaaca
tatttctttgaactactattaggagcatctcatagatatgaactttcagtagaaccaatg
agatttacattaaaacctgattatgcagttgaacttaaatttaaaattaaaatgatatgt
actgctgttgttaatgatgaaattggtattattgcaatggatttagatgaagaaataaaa
gaaactgctaaaatttctattattattgaatctgatttatcaactaaattagatcatact
gaattaaaacttcaaatgcctgctataggtgaaggtgcatttggaatggtttttatagga
agttatagaggtcaaaaagttgctgtaaaaaaaatgaaagcaagaacattaactgaagaa
caagaaaaagaatttaaacatgaagttaatatgttaacacaatatagacatccatgtata
gttaatttagttggagctgtttatacagaaggagaaatatcaattgtaacagaatttgca
gattatggatcactttctaaattatataaaaaagaattattaccttttgatttaaaaatt
aagattatggaagatattgttgttggacttgcatttttacatgaaaataatattattcat
agagatgttaaaggtgaaaatgttttaatttattcattaaacccacattctcaagtttgt
ggtaaattaactgattttggtacttgtagaaatatttctgaaagagctcttcaactacaa
ccattatctcatggaattggaactccaacttatatggcacctgaatgtttagcaaatagt
aattattcttatagtgctgatgtttattcatttgctataatactttatgaaacgtttact
gaacaacaagcatatattgatgatgaacgatttattcaaccttggacaattcctcaattt
gttattgaaggtcatagacttgaaaaaccaaatgatattccagaaaattattggaattta
atcaatcaatgttggactcaagaccctgaagatagacttacatttaatcaaattcatcat
attcttattaactggaaccttgatatttgtaatactgaactatcaacaaataaaaaggat
ccttctcttgattctctttccaattaa

DBGET integrated database retrieval system