KEGG   Entamoeba histolytica: EHI_166920
Entry
EHI_166920        CDS       T00238                                 

Gene name
44.t00030
Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00620  Pyruvate metabolism
ehi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EHI_166920 (44.t00030)
Enzymes [BR:ehi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     EHI_166920 (44.t00030)
SSDB
Other DBs
NCBI-GeneID: 3409079
NCBI-ProteinID: XP_654765
UniProt: C4LY96
LinkDB
AA seq 1151 aa
MFNQEKGTDYPILNIQELEALADLKLSAMGKEYPKHDKSDAIDVVAPLVDIIAEGDQEST
APIDARLQTFLNSYFAECGEEVPKIPDNTFILDREGLGRVLSFPPHKQEFFCETMKSYKI
KQGVLHNPAKDKRTTVGVFHICQSDVPVPADKIECPKIAFLRMLKAAFYGAPDDHLIIPY
TAECKEPTRSWVSLYMRPVVVPGVKGVKGFEHEKATEMHFFVPGNMVSCLDFVESVFGNA
GNPRLSKNDAALDPLGWTGHSGMAILAPHLTRMTKKECGLPHISQATERQKRERMCWEKE
DELYNDGKTFKMYCRDASGVICTIIADNYFGYCKKEVKTQISYSANLYGFAEEEHAGGAV
TRPSYDLGEACKAVQYAEGYKFSEMVEKNKHSIIVKEEGYAVDKKYPEGIIYVPEDSVFT
IEDASIKFNHNGKEESILLTPKVNYVLPNGYTIILHDTMTSRRWTLRGILPQYTLCHKPC
TVSGGGKSEISKNISDAIFEGKMFVNNKEEEFKAVQKVFDHDFSRRYADGEIKSAHILDP
NVTLGTVVKMLTPSSFFTEEHNEFVAAIPPMIVELALTIKSLYREEWKGDWQSRITVDKI
NGKEGHELKYRKMPLPSQYLRVGFERDETTWRVFQLRKDFFPAAKLQMEDDITASVIVPT
KLLKTPINTNGKKACKIVKNCELRLFQRPDDAVFRGYDKQTEYDFSIPGHFISNYQPMTR
EEAKDFTKDVVRLYQYTEPMRKCLQDFVAGKDEAKYIVSSSHTRLVQDGDKLVGSKNPRY
LQRRPDMLDPEYTYMTFKAIQLFRKISDEEPLYTPVDAVLSGRRNNPPQVAKNGMKLRPL
SVFAPLHYFELPELLMECITSMTGASPSMFGAGSEGALTKGPFNSLPAVVDLNNYLLGMI
CCGYSGFVSSASYCGPHYKVAHDISLLIPEIWSRMRRYEQEPKYLIEHGYLEPCPDVTYN
GKTYSGKRLGYRITKDFTVHYFSSIFSVPNSVMPEDFLKPELQDLAIYADSYEYIEQTDK
GIAMNYVKDGTVEGACPPLKALIYIMANGEYNGMTRESKEFREMFDAKTILNSEWYKERL
VTRQKLEVAKLNKDLAYLNKTIAEKPRLAETLNKQIAAVKEELQYVSSEEYLIDIDGSIG
TDPYPYKCMKH
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgtttaatcaagaaaaaggtaccgattatcctattcttaatattcaagaacttgaggca
cttgctgatttaaaattatctgctatgggaaaagaatacccaaaacatgacaaatctgat
gctattgatgttgttgcaccattagttgatattattgctgaaggagatcaagaaagtaca
gctccaattgatgctagacttcaaacattccttaattcatattttgcagaatgtggagaa
gaagtaccaaaaattccagacaatacttttattcttgatagagaaggacttggaagagta
ttatcattcccaccacataaacaagaatttttctgtgaaactatgaaatcatataaaatt
aaacaaggagtacttcataatccagctaaagataaaagaactactgttggtgttttccat
atttgtcaaagtgatgttccagttccagctgataaaattgaatgtccaaaaatagcattc
ttaagaatgcttaaagcagcattttatggagcaccagatgatcatcttattattccatat
acagctgaatgtaaagaaccaactagatcatgggtttcactttatatgagaccagttgtt
gttccaggagttaaaggagttaaaggatttgaacatgaaaaagctactgaaatgcatttc
tttgtaccaggaaatatggtgtcatgtcttgattttgtagagtcagtttttggaaatgct
ggtaatccaagattatctaaaaatgatgctgctcttgatccacttggatggactggacat
agtggaatggctattcttgcaccacatcttactcgtatgacaaagaaagaatgtggactt
ccacatattagtcaagctactgaaagacaaaaacgagaaagaatgtgttgggaaaaagaa
gatgaattatataatgatggtaaaacattcaaaatgtattgtagagatgcatcaggagtt
atttgtactattattgcagataattactttggatattgtaagaaagaagttaaaacacaa
atttcatattcagctaatttatatggatttgcagaagaagaacatgcaggaggagctgtt
actagaccatcatatgatcttggagaagcatgtaaagctgttcaatatgcagaaggatat
aaatttagtgaaatggttgaaaagaataaacattccattattgttaaagaagaaggatat
gctgtagataaaaaatatccagaaggaattatttatgttccagaagattcagtatttaca
attgaagatgcatcaattaaattcaatcataatggaaaagaagaaagtattcttttaaca
ccaaaagtaaattatgttttaccaaatggatatactattattttacatgatacaatgaca
tccagaagatggacattaagaggaattcttccacaatatactctttgtcataaaccatgc
actgtttcaggaggaggaaaatcagaaatttcaaagaatatttcagatgctatatttgaa
ggaaaaatgtttgttaataacaaagaagaagaatttaaagcagttcaaaaagtatttgat
catgacttttcaagaagatatgcggatggagaaattaaaagtgcacatattcttgatcca
aatgttactcttggaacagttgttaaaatgttaacaccatcatcattctttactgaggaa
cataatgaatttgttgcagccattccaccaatgattgtagaattagctttaactattaaa
tctctttatagagaagaatggaaaggagattggcaatcaagaattactgtagataaaatt
aatggtaaagaaggacatgaattaaaatatagaaagatgccacttccatcacaatatctt
agagttggatttgaaagagatgaaactacatggagagttttccaattaagaaaagatttc
ttcccagcagctaaattacaaatggaagatgatattacagcatcagttattgttccaact
aaattacttaaaacaccaattaatactaatggtaaaaaagcatgtaaaattgttaagaat
tgtgaattaagattattccaaagaccagatgatgcagttttcagaggatatgataaacaa
actgaatatgatttctctattccaggacatttcatttctaattatcaaccaatgactaga
gaagaagctaaagacttcactaaagatgttgtaagattgtatcaatacactgaaccaatg
agaaaatgtttacaagactttgttgcaggtaaagatgaggctaaatatattgtttcatca
tctcatactagattagttcaagatggagataaacttgttggatcaaagaatccaagatat
ttacaaagaagaccagatatgttggatccagaatatacatacatgacatttaaagctatt
caattatttagaaagattagtgatgaagaaccattatatactccagttgatgctgttctt
tcaggaagaagaaacaacccaccacaagtagccaaaaatggtatgaaattaagaccatta
tcagtttttgcaccattacactattttgaattaccagaattattaatggaatgtattact
tctatgacaggagcatctccatcaatgtttggagcaggatcagaaggagcattaactaaa
ggaccattcaattcacttccagctgtagttgatttaaataattatcttcttggaatgatt
tgttgtggatattcaggatttgtttcatcagcatcatattgtggaccacattataaagtt
gcacatgatatttcattattaattccagaaatttggtcaagaatgagaagatatgaacaa
gaaccaaaatatttgattgaacatggatatcttgaaccatgtcctgatgttacttataat
ggaaaaacatattcaggaaaaagacttggatatagaattactaaagactttacagtacat
tacttctcatctattttctcagtaccaaattctgttatgccagaagatttccttaaaccc
gaattacaagatttagctatttatgcagattcatatgaatatattgaacaaactgataaa
ggaattgctatgaattatgttaaagatggaactgttgaaggagcatgtccaccattaaaa
gcacttatttacattatggcaaatggtgaatataatggaatgacacgagaatctaaagaa
tttagagaaatgtttgatgctaaaactattcttaatagtgaatggtataaagaaagatta
gttacaagacaaaaacttgaagttgctaaattaaataaagacttagcttatttgaataag
acaattgctgaaaaaccaagattagctgaaacacttaataaacaaattgctgctgttaaa
gaagaacttcaatatgtctcaagtgaagaatatcttattgatattgacggatctattgga
actgatccatatccatacaaatgcatgaaacattaa

DBGET integrated database retrieval system