KEGG   Eubacterium hallii: EHLA_2911Help
Entry
EHLA_2911         CDS       T05310                                 

Definition
(GenBank) small_GTP: small GTP-binding protein domain
  KO
K02358  elongation factor Tu
Organism
ehl  Eubacterium hallii
Brite
KEGG Orthology (KO) [BR:ehl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ehl03012]
    EHLA_2911
   03029 Mitochondrial biogenesis [BR:ehl03029]
    EHLA_2911
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ehl04147]
    EHLA_2911
Translation factors [BR:ehl03012]
 Eukaryotic Type
  Elongation factors
   EHLA_2911
 Prokaryotic Type
   EHLA_2911
Mitochondrial biogenesis [BR:ehl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EHLA_2911
Exosome [BR:ehl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EHLA_2911
  Exosomal proteins of breast cancer cells
   EHLA_2911
  Exosomal proteins of colorectal cancer cells
   EHLA_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: SOB73465
UniProt: A0A285PZT6
LinkDB All DBs
Position
I:complement(3049139..3050332)
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITKVLAERVEGNEKVDFENIDKAPEERER
GITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGVMAQTKEH
ILLSRQVGVPYIVVFMNKCDMVDDEELLELVDMEIRELLNEYDFPGDDTPIIQGSALMAL
EDPNGEWGDKIMELMDAVDTWIPNPERDTDKPFLMPIEDIFSITGRGTVATGRVERGALH
VSDEVEIVGITDETRKVVVTGVEMFRKLLDEAQAGDNIGALLRGVQRDEIQRGQVLAQPG
SVTCHHKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVITLPEGTEMCMPGDNV
EMTIDMIHPVAMEQGLTFAIREGGRTVGSGRVASIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaagtttgagagaactaaaccacattgtaatattggtaccatcggacac
gttgaccatggtaaaacaactttaacagctgctatcacaaaagtattagctgaaagagta
gaaggaaacgaaaaagtagatttcgaaaacatcgataaagctccagaagaaagagaacgt
ggtatcacaatctctacagctcacgttgagtacgaaacagagaagagacattacgcacac
gttgactgtccaggtcatgccgattatgtaaagaacatgatcactggtgctgctcagatg
gatggagctatccttgtagtagctgctactgatggtgttatggctcagactaaagagcac
atcttattatcccgtcaggtaggtgtaccttacatcgtagtattcatgaacaaatgtgat
atggtagacgatgaagagttacttgagttagtagacatggaaatccgtgaattattaaac
gagtacgacttcccaggagatgacactccaatcatccagggttcagctcttatggctctt
gaagatcctaacggagaatggggagataagatcatggaacttatggacgctgttgataca
tggattcctaacccagaacgtgacacagataagcctttcttaatgcctatcgaggacatc
ttctctatcacaggtcgtggtactgttgcaactggtagagtagagcgtggtgcattacac
gtatctgatgaagtagaaatcgttggtatcacagacgaaacacgtaaagttgttgtaact
ggtgttgaaatgttccgtaaattacttgacgaagctcaggctggtgacaacatcggagct
cttcttcgtggtgttcagagagacgaaattcagcgtggacaggtattagctcagccaggt
agcgtaacatgccatcataagttcacagctcaggtttacgttttaacaaaagatgaaggt
ggacgtcatactcctttcttcaacaactacagacctcagttctacttccgtacaactgac
gtaacaggtgttatcactcttccagaaggaacagagatgtgcatgcctggtgataacgta
gaaatgacaatcgacatgatccatccagtagctatggagcagggtcttacattcgctatc
cgtgaaggtggacgtactgtaggatcaggacgtgttgcttctatcatcgagtaa

DBGET integrated database retrieval system