KEGG   Enterobacter hormaechei: AB284_04710Help
Entry
AB284_04710       CDS       T04593                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ehm  Enterobacter hormaechei
Brite
Enzymes [BR:ehm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AB284_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: ANS15976
LinkDB All DBs
Position
772516..773136
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacaccaccagacctatgtgaacaacgcgaat
gctgcgctggaaagcctgccagagttcgctaatctgcctgttgaagagctgatcaccaaa
ctggaccagctgccggcagacaagaaaaccgtgctgcgcaacaacgcgggcggtcacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccacccttcagggcgacctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagcggaattcgaaaaagcc
gctgcaacccgtttcggctctggctgggcgtggctggtcctgaaaggtgacaaactggcg
gtcgtttctaccgctaaccaggactccccgctgatgggtgaagctatctctggcgcatcc
ggcttcccaattctgggtctggacgtgtgggaacacgcttactacctgaagttccagaac
cgtcgccctgactacatcaaagccttctgggatgtagtaaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system