KEGG   Enterobacter hormaechei CAV1176: AB284_04885Help
Entry
AB284_04885       CDS       T04593                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00220  Arginine biosynthesis
ehm01100  Metabolic pathways
ehm01110  Biosynthesis of secondary metabolites
ehm01130  Biosynthesis of antibiotics
ehm01210  2-Oxocarboxylic acid metabolism
ehm01230  Biosynthesis of amino acids
Module
ehm_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AB284_04885
Enzymes [BR:ehm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     AB284_04885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ANS16010
UniProt: A0A3S0HGB2
LinkDB All DBs
Position
complement(810255..811406)
Genome map
AA seq 383 aa AA seqDB search
MKMNLPPFIEIYRALIATPSISATEEALDQSNESLINLLAGWFSDLGFNVEVQPVPGTRH
KFNLLASTGHGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDALRDVDVTTLKKPLYILATADEETSMAGARYFSENTSIRPDCAIIGEPTSLQPIRAHK
GHISTAVRVLGQSGHSSDPARGVNAIELMHDAIGRIMTLRDDLKERYHYEAFTVPYPTLN
LGSLHGGDASNRICACCELHMDIRPLPGMTLSDLDGLLNEALAPVSERWPGRLTVSELHP
PIPGYECPPDHQLVQVVEKLLGEKTDVVNYCTEAPFIQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVVHHFCWH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaacttaccgccatttatcgagatttaccgcgccctgattgccacaccctcc
atcagcgcgacggaagaagccctggatcagagcaatgagtctttaatcaatctgctggcg
ggttggtttagcgatcttgggtttaacgttgaggttcagcccgtccccggaacacgccac
aaatttaacctgctcgccagtaccggacatggcgcgggcggcctgctgctggctggccac
acagacaccgtgccgtttgatgatggccgctggacgcgcgatccgttcacgctgaccgaa
catgacaacaaactctacggtttgggcaccgccgacatgaaaggctttttcgcctttatc
ctcgacgcgctgcgtgacgtggacgtgacaaccctgaaaaagccgctctacattctggcg
accgccgatgaagagaccagcatggcgggcgcacgttatttctctgaaaacacatcgatt
cgtcctgactgcgcgatcatcggcgaaccgacctctctgcaaccgattcgggcgcacaaa
ggccatatttctaccgcggtgcgcgtgctcggacagtccggccactccagcgatccggcg
cgcggcgtgaacgccatcgagctgatgcatgacgcgattggccgcatcatgaccctgcgc
gacgatctgaaagagcgctatcactacgaggcgttcaccgtgccgtatccgacgctaaac
ctcggcagcctgcacggcggtgatgcgtccaaccgtatctgcgcctgctgcgaactgcat
atggatatccgtcctctgccgggcatgacgctaagcgatctggatggcttactgaacgaa
gcgctggcaccggtcagcgagcgctggccgggccgtctgacggtctccgaactgcatccg
ccgattccaggctacgaatgtccgcctgaccatcagctggttcaggtggtggaaaaactg
ctcggcgagaaaaccgacgtggtgaactactgtaccgaagcgccgtttattcagacgctg
tgcccgacgctggttctgggccctggctccatcaaccaggcccaccagccggacgaatat
ctcgaaacccgcttcatcaagcccactcgcgaactcattacccaggttgtgcatcacttc
tgctggcattaa

DBGET integrated database retrieval system