KEGG   Enterobacter hormaechei CAV1176: AB284_11105Help
Entry
AB284_11105       CDS       T04593                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00550  Peptidoglycan biosynthesis
ehm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB284_11105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ehm01002]
    AB284_11105
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ehm01011]
    AB284_11105
Enzymes [BR:ehm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AB284_11105
Peptidases [BR:ehm01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AB284_11105
Peptidoglycan biosynthesis and degradation proteins [BR:ehm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AB284_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CDPS
Motif
Other DBs
NCBI-ProteinID: ANS17166
UniProt: A0A4U2KQ85
LinkDB All DBs
Position
2140015..2141181
Genome map
AA seq 388 aa AA seqDB search
MKRRLFIAVSLLASSISSALAAEPLDFSPQPPAIQAGSWVLMDYTTGQILTAGNEHQQRN
PASLTKLMTGYVVDRAIDSHRISPDDIVTVGRDAWAKGNPVFDGSSLMFLKEGDRVSVRD
LSRGLIVDSGNDACVALADHVAGGQPQFVRMMNDYVEKLNLRDTHFETVHGLDAPGQHSS
AYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMNVDGLKTGHTSGAG
FNLIASAVDGQRRLIAVVMGADSPKGREDQARKLLHWGQQNFDTVQILHNGKKVGTERIW
YGDKEQIALGTDQDFWLALPKSEVPNIKAKYVMDKKELEAPIAAHQRVGEIQLYDRDKVV
AHWPLVTLESVEKGGLFSRLGDYLHHKL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtctgtttattgctgtttctttactcgcttcgagtatttcatccgcgctg
gctgccgagccgctggatttttcacctcagccgcctgccatccaggctggctcctgggta
ttgatggattacaccacgggtcaaatcttaacggcgggcaacgaacatcagcagcgtaat
ccggcgagcctgaccaaactgatgacggggtacgttgtcgatcgtgctattgatagccac
cgcatcagccccgatgacattgtgacggtcggacgtgacgcctgggcaaaaggcaatccg
gtctttgacggttcgtcgctgatgtttctgaaggagggcgatcgggtttccgtgcgcgat
ctcagccgcggcctgattgttgattccggcaatgacgcctgcgtggcgctggcggatcac
gtggcgggcggtcagccgcagttcgtcaggatgatgaatgactacgttgaaaagctgaac
ctgcgcgatacccacttcgaaaccgtacacgggctggatgcaccgggtcagcacagctcc
gcttacgatctcgccgtgctttcccgggccatcattcacggcgagcctgagttctatcac
atgtacagcgaaaagagcctgacctggaacggcatcacccagcagaaccgcaacggcctg
ctgtgggataagaccatgaacgtggatggcctgaaaacgggtcacacctcgggcgcgggc
tttaacctgattgcctccgcggtggacggtcagcgtcgactgattgcggtggtgatgggg
gcagacagcccgaaaggacgtgaagatcaggcgcgcaagctgctgcactggggacagcaa
aattttgatacggtgcagatcctgcataacggtaaaaaagtgggaaccgagcgcatctgg
tacggcgataaagagcagatcgcgctgggcacggatcaggacttctggctggcattaccc
aaatcggaagtgccgaacatcaaggcgaaatacgtgatggataaaaaagagctggaagcg
ccgatcgccgcgcatcagcgggtaggggagatccagctgtacgatcgtgacaaggtggta
gcgcactggccattggttacgctggaaagcgttgaaaagggcggccttttctcccgcctc
ggcgattatctgcatcataaactctga

DBGET integrated database retrieval system