KEGG   Enterobacter hormaechei CAV1176: AB284_12330Help
Entry
AB284_12330       CDS       T04593                                 

Definition
(GenBank) peptidoglycan synthase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00550  Peptidoglycan biosynthesis
ehm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB284_12330
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AB284_12330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ehm01011]
    AB284_12330
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ehm03036]
    AB284_12330
Enzymes [BR:ehm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AB284_12330
Peptidoglycan biosynthesis and degradation proteins [BR:ehm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AB284_12330
Chromosome and associated proteins [BR:ehm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AB284_12330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ANS17389
UniProt: A0A2K0QGN5
LinkDB All DBs
Position
2370567..2372312
Genome map
AA seq 581 aa AA seqDB search
MKKKTITTTGNFTPARFALLCLAIFCSLAFLLGRVAWLQIIKPDNLVKQEDMRSLREVAI
DAPRGMIVDREGRPLAVSVPVQAVWADPKTVLQKGGIGFDSRWQALANALHLSLSTLASR
INSNPHGRFIYLARQVDPAQAKWIDKLRLPGINLRDESRRFYPAGHVAANLIGFTNIDGQ
GIEGVEKSFNTQLTGKAGVRLVRKDRYGHVVENLTEVAPVPAHNIQLSIDERLQTITEDA
LDNAVAWNKAESGASVLINIRTGEILAMASFPDFNPNNREGATLDDFRNRAISDTFEPGS
TVKPLVLMTALQQGLVQPDSVIDTHPYTIDGHRIRDVGYYPELTMTGILQKSSDTGVSRL
SLAMPVQRLLDTYKNFGFGESTGLGLTGESAGLLPQRKFWSQLDRATFAFGYGLMVTPLQ
LAHVYATIGSYGIERPLSITRIDPPVIGKRVMPEEIVHEVEHMMESVALPGGGGVKAAVR
NYRVAIKTGTAKKIDEHGKYVDKYVAYTAGVAPASDPRFALVVVINDPQNGAYYGGAVSA
PVFSEIMGNVLRLENVKPDGLPADSDHLIVMRHPAVYNPGE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaaagacaataaccaccaccggaaattttactccggcacgttttgcacttctg
tgtctcgccatcttttgtagccttgcgtttctgctgggccgcgtagcgtggctacaaatt
atcaaaccggataatctggtgaagcaggaggatatgcgctccctgcgcgaagtggcgata
gacgccccgcgtgggatgattgttgaccgtgaagggcgaccccttgcggtgagcgtaccc
gtccaggccgtctgggccgatcccaaaacagtgctgcaaaaaggggggatcggttttgac
tcgcgctggcaggccctggcaaatgccttacacctttctctgagcacgctcgcatcgcga
attaacagtaacccgcacgggcgatttatttacctggcccgtcaggttgatcccgcccag
gcaaagtggatcgataagctgcgtctccccggtatcaaccttcgcgatgagtcccgccgc
ttttatcctgccgggcacgtggcggcgaacctgattggcttcaccaatattgatggtcag
ggcattgagggcgtcgagaaaagctttaacacgcagcttaccgggaaggcaggcgtgcgg
ctggtcaggaaagatcgctacggacatgtggtggagaaccttacggaggtggctcccgta
cctgcacataatatccagcttagtatcgatgaacgcctgcaaactatcaccgaagacgcg
ctggataatgccgtggcgtggaacaaagccgagtcaggcgcgtcggtgctgattaatatc
cggacgggcgaaattctggcgatggcgagcttccccgacttcaatcccaacaaccgggaa
ggggcaacgctggatgattttcgcaatcgcgcgatcagcgacacctttgaacctggctcg
accgttaagcctctggtgctgatgacggcgctacagcaggggctggtacagcctgacagc
gtgatagatacgcatccctacaccattgatggtcatcgtattcgtgatgtgggctactac
cccgagctgacgatgaccgggattttgcaaaaatccagcgacacaggcgtatcccgtctt
tcgctggcgatgcccgtgcaacggttactggatacctataaaaactttggttttggcgag
agtaccgggcttggtttaacgggagaaagcgcaggtttactgccgcagcgaaaattctgg
agtcagttagatcgggcgacctttgcctttgggtatggcctgatggtaacccccctccag
ctggcgcatgtgtatgccaccatcggcagctacggcattgaacggcctctgtccatcacc
cgtattgacccgccggtgattggcaagcgggtgatgcccgaggaaattgttcacgaggtg
gaacatatgatggagagcgttgcgttacccggcggtggcggggtcaaagcggcggtgcgt
aactatcgcgtggcgataaaaaccgggacggccaaaaaaatcgatgaacatggtaagtat
gtggataaatacgtcgcctataccgcaggcgttgcgcctgccagcgatccccgtttcgcg
ctggtggtggtgatcaacgatccgcaaaacggtgcctactatggcggggccgtttctgcg
cccgtgttcagcgaaattatgggtaacgtcctgcgcctggaaaacgtgaagccagacggg
ctgccggcagattctgaccatctgatcgtgatgcgtcacccagccgtttataaccctggc
gaatag

DBGET integrated database retrieval system