KEGG   Enterobacter hormaechei CAV1176: AB284_15380Help
Entry
AB284_15380       CDS       T04593                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00480  Glutathione metabolism
ehm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AB284_15380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ehm02000]
    AB284_15380
Enzymes [BR:ehm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AB284_15380
Transporters [BR:ehm02000]
 Other transporters
  Pores ion channels [TC:1]
   AB284_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: ANS17955
UniProt: A0A3L9P992
LinkDB All DBs
Position
3040160..3040765
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKLQYVNDALKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHVAS
YMTRVAERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggcgcctgctctcttgcttcccatattacgcttcgcgag
agcggtaaagatttcacgctggacggcgttgacctgatgaaaaagcgtctggaaaacggg
gatgacttttttgcgattaacccaaaaggccaggttccggccctgctgctggatgatggc
accctgctgaccgaaggggtggcgattatgcaattcctggcggacaacgtaccggatcgt
cagctccttgcccccaccggcagcattgcgcgttataaaacgctggagtggctgaactat
attgccaccgaactgcacaaaggctttacgcccctgttccgcccggacacgccggaagag
tacaaacctaccgtgcgcgcgctgctggagaaaaagttgcagtacgttaacgacgcgctg
aaagacgaccagtggatctgtggctcgcgtttcaccatcgccgatgcctatctgtttacc
gttctgcgctgggcgcgcgcggttaagctgaacatggaaggattagaccatgtcgcatcg
tatatgacgcgcgtggcggagcgtcctgcggtggcagcggcgctgaaagcggaagggttg
aattaa

DBGET integrated database retrieval system