KEGG   Enterobacter hormaechei CAV1176: AB284_20835Help
Entry
AB284_20835       CDS       T04593                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00061  Fatty acid biosynthesis
ehm00780  Biotin metabolism
ehm01100  Metabolic pathways
ehm01212  Fatty acid metabolism
Module
ehm_M00083  Fatty acid biosynthesis, elongation
ehm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AB284_20835
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AB284_20835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ehm01004]
    AB284_20835
Enzymes [BR:ehm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AB284_20835
Lipid biosynthesis proteins [BR:ehm01004]
 Fatty acid synthase
  Component type
   AB284_20835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ANS18956
UniProt: A0A330DRI4
LinkDB All DBs
Position
complement(4163711..4164166)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVAMVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagattttagaacttctgccgcaccgc
tatccgtttttactggtagaccgtgtgctggattttgaagaaggtcgttttctgcgcgca
gtgaaaaatgtctccgttaacgagccgttcttccaggggcacttccctggtaagcctatc
ttcccgggtgtattgatcctggaagcgatggcacaggctaccggtattctggcgtttaaa
agcgtaggtaaactggaaccgggtgaactctattacttcgcgggtatcgatgaagcgcgc
ttcaagcgtccggtcgtgcctggtgatcaaatgatcatggaagtcacttttgaaaaaacg
cgtcgcggcctgactcgcttcaaaggcgtagctatggttgacggcaaagttgtttgcgaa
gcgacaatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system