KEGG   Edwardsiella hoshinae: A9798_00700Help
Entry
A9798_00700       CDS       T04508                                 

Definition
(GenBank) transporter
  KO
K03308  neurotransmitter:Na+ symporter, NSS family
Organism
eho  Edwardsiella hoshinae
Brite
KEGG Orthology (KO) [BR:eho00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A9798_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-ProteinID: AOV95604
LinkDB All DBs
Position
160270..161619
Genome map
AA seq 449 aa AA seqDB search
MSQALDSDQAVSRAPQWSSRVGHILAAAGSAIGIGAIWKFPYVTATNGGGAFLLLFLLFS
FTLGLAVFMAETLLGSHSRQSVVQAFRQLCGRHWGWVGLLGIITSWCIYSFYSVVGGWTV
GYTLMAAAGRFQGGEAQGFQRLFSHYISHPYWPVMTHLLFAALTAYVVLGGVQRGVEKAV
KVMMPLLLVIMLALIAIALTLPGATAGLHLFLWPDFSHLTGKSVLDALGLAFFSLSVGLG
IHTTYGAYLPSSDGVARSSLWVVALSCLVCVLAGLMIFPALSAAGLDPSAGPGLTFMTMP
VFFNHLPFASVWAVAFFVLLLLAALSSSISLLEHIVAFASGRWGWSRRNATLLVSVSIML
AGIPVTLSFGPLADYTWAGRTLFDWLDFMTSNLMMPLFALVICLLFGWSPRLEGLLPPTL
SPLWRRALRVTWRYAAPLCIGVILLHGLY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgttagacagcgatcaggcggtgagccgcgctccccaatggtcatcgcgc
gtgggccatatcttggccgccgccggctcggcgatcggtattggcgccatctggaagttc
ccctatgtgacggctactaacggtggcggtgctttcctgctgctattcctgctgtttagc
tttaccctgggattggcggtctttatggccgagacgctgctgggtagccatagccgtcag
agtgtggtgcaggcgtttcgtcagttgtgcggccgtcattgggggtgggtcggtctgctc
ggtatcatcaccagttggtgtatctatagcttttatagcgtggttggcggttggacagtg
ggctatacgttgatggccgctgccggtcgctttcaggggggggaggcgcaggggtttcag
cgtctgtttagtcactacatcagccacccctattggccggtgatgactcacctgttgttc
gccgcgctgaccgcctatgtggtgttgggcggggtacagcgtggggtggagaaagcggta
aaggtgatgatgccgttgttactggtgatcatgctggcgctgatcgctatcgccttgact
ctgccgggggcgaccgcgggcctgcatctttttttgtggcccgacttcagccatctgacg
gggaaaagcgtcttggatgcgttgggcctggcatttttctccctgtccgtcggtctgggg
atccataccacctatggggcctatctgccgagcagtgatggcgtggcgcgttccagccta
tgggtggtggcgctgtcctgtttggtttgcgtattggccggcttgatgatctttccagcg
ctgagtgccgccggtctggacccgagcgccggcccggggctgacctttatgaccatgccg
gtcttctttaaccatctgcctttcgctagcgtgtgggcggtggcgtttttcgtcttactg
ctgctggcggcactctcttcctctatctccttgttggagcatatcgtggctttcgccagc
ggccgttggggatggtcacgccgtaacgcgactttattggtcagtgtcagcatcatgctg
gctgggatcccggttaccttgtcgtttggcccgctggccgattacacctgggcggggcgg
acgttgttcgattggctggactttatgacctcgaacctgatgatgccgctgtttgccctc
gtcatctgcctgttgtttggctggtccccacggttggaaggcctgttgccgccgacgttg
tcgccgttgtggcgccgggcattgcgtgttacctggcgttatgcggctccgctgtgcatt
ggggtgatcttgttgcatggtctgtactaa

DBGET integrated database retrieval system