KEGG   Edwardsiella hoshinae: A9798_00885Help
Entry
A9798_00885       CDS       T04508                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00564  Glycerophospholipid metabolism
eho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A9798_00885
Enzymes [BR:eho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A9798_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_oxidored FAD_binding_3 GIDA Lycopene_cycl FAD_binding_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AOV95640
UniProt: A0A376D6H7
LinkDB All DBs
Position
199479..200966
Genome map
AA seq 495 aa AA seqDB search
MEIKDVIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPLRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTTLPGS
RSLRFAADSVLQPNLTRGFEYSDCWVDDARLVVLNAMAVAEKGGEVRTRTEVTRAWREQG
LWVVEARDTLSGECLTWRARGLVNATGPWVKQFFDDSLQLKSPYGIRLIKGSHIVVPRVH
DQPQAYILQNEDQRIVFVIPWLDEFSIIGTTDVEYHGDPRAVAIDDQEIDYLLRVYNRHF
QRPLSRQDIVWCYSGVRPLCDDESDAPQAITRDYTLDIHDQNGQAPLLSVFGGKLTTYRK
LAEHALEKLRPYYTHCGDAWTKGAVLPGGEMGCDRDSYAVALQRRHGWLPPALARRYAHT
YGARSERVIGVATSLAALGEHFGHGLYEAELRYLMAQEWVVTAEDALWRRTKLGMWLDET
QRQRVADWLAVQRAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcaaagacgtgatcgtaatcggtggcgggatcaatggcgcggggatcgcggca
gatgccgccggccgcgggttatcagtcctgatgctggaggcgcgtgatctggcttgcgct
acctcctcggccagttccaaactgattcacggcggtttgcgttatttggagcattatgag
tttcgcctggtcagtgaagcgctggccgaacgcgaagtattactgaagatggcgccgcat
attgcctttccgctacgcttccgcctgcctcatcaaccccatttacgcccggcctggatg
atccgtgccggtttatttctctatgatcatttggggaagcgtaccaccttgccgggaagt
cggagcctgcgtttcgcggctgactcggtgttacaacccaatctgacgcgcggtttcgag
tattcggattgttgggtcgatgatgcgcgcctggtggtgctgaatgctatggccgtggcg
gagaaggggggggaggttcgtacgcgtactgaagtgactcgtgcttggcgtgagcagggg
ctatgggtagtcgaagcgcgcgatacgctgagcggtgagtgcctgacctggcgcgcgcgc
ggcctggtgaatgccacggggccctgggttaagcagttctttgacgacagtctacagctc
aagtcgccctatggcatccgcctgatcaagggcagtcatatcgtggtgccgcgggtacac
gatcagcctcaggcttatatcttgcagaatgaggatcagcgcattgtgttcgtcattccc
tggcttgatgagttctcgatcatcgggacgaccgatgtggagtaccacggcgatccgcgt
gcggtagccatcgatgatcaagagatagactatctgctgcgggtgtataaccgccacttc
cagcgtcctctgagccgtcaggatatcgtctggtgctattccggcgtacgcccgctgtgt
gatgacgaatccgatgctccgcaggccatcacccgtgactacacgttggatatccacgat
cagaatggtcaggctccacttctgtcggtgtttggcggtaagctgacaacctaccgtaag
ttggcggagcatgcgctagaaaaactgcgcccctactatacccattgcggcgacgcctgg
accaagggggcggtgttgcctggcggtgagatgggctgcgatcgtgatagctatgccgtg
gcgctacagcgccgccatggttggctgccgccggcgttggcccgccgttatgcgcatacc
tacggcgcacgcagcgagcgagtgatcggtgtggcgacctcactggcggcattgggcgaa
catttcgggcatggcttgtatgaggcagagctgcgttacctgatggcccaggagtgggtc
gtgacggcggaggacgccctatggcgtcgtactaagctgggaatgtggctggatgagacg
cagcgtcagcgggtcgctgactggctggcggtgcagcgtgccgcttaa

DBGET integrated database retrieval system