KEGG   Edwardsiella hoshinae: A9798_02865Help
Entry
A9798_02865       CDS       T04508                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00250  Alanine, aspartate and glutamate metabolism
eho00410  beta-Alanine metabolism
eho00430  Taurine and hypotaurine metabolism
eho00650  Butanoate metabolism
eho01100  Metabolic pathways
eho01110  Biosynthesis of secondary metabolites
eho01120  Microbial metabolism in diverse environments
eho02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9798_02865
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9798_02865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9798_02865
   00430 Taurine and hypotaurine metabolism
    A9798_02865
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A9798_02865
Enzymes [BR:eho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A9798_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AOV96000
UniProt: A0A1D8MVG9
LinkDB All DBs
Position
670113..671507
Genome map
AA seq 464 aa AA seqDB search
MKKGHDIHGEYLDSRFGAQAMRTAAEAHHFPQGEMRADIAFQVINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPAHGQAVGTN
TIGSSEACMLGGMAMKWRWRAKRLAAGKSVDKPNLVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDAERMIAACDENTIGVVPTFGVTYTGNYEMPEALHQALDDLQARTGLDIDMHI
DAASGGFLAPFCAPDIVWDFRLPRVKSISSSGHKFGLAPLGCGWVVWRDAAALPDDLVFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGQDLGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
LMCRRGFEMDFAQLLMADFRAALAYLKAHPTAAHIAQQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggtcatgatattcatggggaatatttggattctcgttttggcgcgcaagcc
atgcgcacggcggccgaagcgcaccactttcctcaaggcgaaatgcgcgcggatatcgcc
ttccaggtgatcaacgatgagctatttttagacggtaacgcccggcaaaacctggcgaca
ttttgccagacctgggatgacgattatgtacaccgcctaatggatatttcgatcaataag
aactggatcgataaagaggaatatccgcaatccgccgccatcgatctacgctgcgtcaac
atggtggccgacctgtggcatgccccacgccccgcgcatggccaagccgtcgggaccaac
accatcggctcctccgaggcctgtatgctgggcggtatggcgatgaagtggcgttggcgc
gccaaacggctggcggcaggaaaatcggttgataagccgaatctggtgtgcggcccggtg
caagtctgctggcataagttcgcccgttactgggatgtcgaactgcgtgaaatcccgatg
gcccccggcaaactatttatggatgcggagcgcatgatcgccgcctgcgacgagaacacc
atcggcgtcgtgccgaccttcggtgttacctataccggcaactatgagatgcccgaggcg
ctgcaccaggcgctggacgatctgcaagcgcgcaccggtctggatatcgacatgcacatc
gatgccgccagcggtggcttcctggcaccgttctgcgccccggatatcgtctgggacttc
cgcttgccgcgtgttaaatccatcagttcatccggccataaattcggcctggcaccgctt
ggctgtggctgggtggtgtggcgtgacgccgccgccctgccagacgatctggtattcaag
gttgactacctcggcggtcaggtcggcaccttcgcgattaacttctcccgcccggccggc
caggtgatcgcccaatactatgagttcctgcgcctgggacgtgaggggtacaccaaggta
cacaccgccagctatcaggtggcgcagttcctggcggcggagatcgccaaactggggccc
tatgagtttatctgtagcggcgatccgcaacaggggattccggcggtctgtttccgtatt
ccggccgggcaggatctgggttatagcctgtatgatctctccgagcgtctacgcctacgc
ggttggcaggtgccggcctttgccctgaatggtgagatgtccgacgtggtggtgatgcgc
ctgatgtgccgtcgtggcttcgagatggacttcgcccagctgttgatggcggacttccgc
gcggcactggcttacctcaaggcccatccgacggcggcgcatatcgcccagcagaatagc
ttcaagcattcctga

DBGET integrated database retrieval system