KEGG   Edwardsiella hoshinae: A9798_04375Help
Entry
A9798_04375       CDS       T04508                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00020  Citrate cycle (TCA cycle)
eho00190  Oxidative phosphorylation
eho00650  Butanoate metabolism
eho01100  Metabolic pathways
eho01110  Biosynthesis of secondary metabolites
eho01120  Microbial metabolism in diverse environments
eho01130  Biosynthesis of antibiotics
eho01200  Carbon metabolism
Module
eho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eho_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9798_04375
   00650 Butanoate metabolism
    A9798_04375
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9798_04375
Enzymes [BR:eho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A9798_04375
    1.3.5.4  fumarate reductase (quinol)
     A9798_04375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOV96256
UniProt: A0A376DA52
LinkDB All DBs
Position
994512..996278
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQQGFRCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPDAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAIVGC
TALCIETGEVVYFKSRATILATGGAGRIYQSTTNAHINTGDGIGMALRAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTRISGQALTQDTNGADQVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGLHLA
QSLQEQGPLRQASESDIEASLARLHRWNGTRKGEDPAQIRKDLQSCMQHNFSVFREGEAM
AQGLAELKTIRERLASARLDDTSSEFNTQRIECLELDNLMATAFATAMAANYRTESRGAH
SRFDFPQRDDANWLCHTLYLPESERMVQRHVNMQPKLRAAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtgagagagtttgacgccgtggtgatcggcgccggtggtgcgggcatg
cgcgccgcattgcagatttcgcaacaaggattccgttgcgccttactatcgaaagtcttt
cctacccgttcccataccgtctcggcgcaaggtggcatcaccgtggcgttaggcaatacc
cacgaagataactgggaatggcatatgtacgataccgtgaagggatcggactacatcggc
gatcaggatgccatcgaatatatgtgtaagaccggtcccgatgccatccttgagttggag
catatggggttacctttctctcgcctggatgatgggcgcatttatcagcgtccgttcggt
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtaccgcggcggcggcggatcgt
accgggcacgccttgctgcacaccctgtatcagcaaaacctgaagaatcacaccaccatc
ttctctgaatggtatgccttggatctggtgaagaacgcggatggggcgatagtcggttgt
accgccttgtgcattgagactggcgaggtggtttacttcaagtcgcgcgccacgatcctg
gccaccggtggagccggacgtatctaccagtcgaccaccaacgcgcatatcaacactggt
gatgggatcgggatggcgctgcgcgcgggggtgccgttacaagacatggagatgtggcag
ttccatccgaccgggatcgctggcgccggggtgctggtgacggagggatgccgcggcgaa
ggcggctatctgctgaataaacacggtgagcgctttatggagcgttatgcgccgaacgcc
aaggatctggcggggcgcgacgttgtcgcgcgctcgatcatgatcgagatacgcgaaggg
cgtggctgcgacgggccctggggaccccacgccaaattgaagctcgatcacctgggtaaa
gaggtgttggagtcccgtctgccaggtatcctagagctgtcgcggacgttcgcccacgtc
gacccggtcaaagagccgatcccggtgatcccaacctgtcactatatgatgggtggcatt
ccgacccgtatcagcgggcaggcgttgacccaagacaccaatggtgccgatcaggtgatc
cctgggctgtttgccgtcggcgaaatcgcctgtgtctcggtgcatggcgctaaccgtctg
ggcggcaactcgctgctggatctggtcgtgtttggccgctcggctggtctgcacctggcg
cagagcctgcaagagcaagggccgctacgtcaggccagtgaatcagatattgaggccagc
ctggcacgattacaccgttggaacggcacccgcaaaggggaggatccggcacagatccgc
aaagatctgcaatcttgtatgcagcacaacttctccgtgttccgcgaaggtgaggcgatg
gcgcaaggtttggccgagctgaagacaatccgggagcgcctggccagcgctcgtctggat
gacacctctagcgaattcaacacccaacgtatcgagtgcctagagttggataacctgatg
gccacggccttcgctaccgccatggcggctaactaccgtaccgaaagccgtggggcgcac
agccgtttcgacttcccgcagcgcgatgacgccaactggctgtgccacaccctctatctg
ccggagagcgaacgcatggtgcagcgtcacgtcaatatgcagcctaaactgcgcgcggcg
ttcccgccgaaggtgcggacctactga

DBGET integrated database retrieval system