KEGG   Edwardsiella hoshinae: A9798_05610Help
Entry
A9798_05610       CDS       T04508                                 

Definition
(GenBank) Bcr/CflA family drug resistance efflux transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
eho  Edwardsiella hoshinae
Brite
KEGG Orthology (KO) [BR:eho00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eho02000]
    A9798_05610
Transporters [BR:eho02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    A9798_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 MFS_4 MFS_1_like Folate_carrier
Motif
Other DBs
NCBI-ProteinID: AOV96475
UniProt: A0A376DBY2
LinkDB All DBs
Position
1260231..1261424
Genome map
AA seq 397 aa AA seqDB search
MAERKGSYLGLILILGLLSMLMPLAIDMYLPSLPVIAAQFGVSGGEVQMTLSAYTLGFAA
GQLLYGPLADSVGRKPVILFGTLSFALAGAACALAQSIDQLIVLRLLHGLAAAAASVVIN
ALMRDMFSKDEFSRMMSFVVLVMTIAPLLAPLLGGALMLWFSWHAIFWVMAAAALCATLL
VARFIRETLPRERRQPFRLYTTLTNFATLFRHRRVLSYMLAGAFSFSGMFSFFSAGPFVY
IELHGVSPQHFGYYFALNILFLFLMTTFNGRHVRRRGAQTMLCLGLAVQFIMGLWLLACV
SLDWGFWALVLGVAAYVGCIAMVSSNAMAVILDSFPHMAGTAASLAGTLRFGLSALVGAL
LAQLPITSAWPLVGSMALCSTLAMALFLYAARAPTAG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgtaagggatcttatctgggattgatcttgatcttagggctgttgtcgatg
ttgatgccgttagccatcgacatgtatctgcccagcctgccggtgatcgccgcacaattc
ggcgtgtccggtggcgaggtgcagatgacgttgagcgcctacaccttgggtttcgccgcg
ggtcagctgctgtatgggccgctggctgacagtgtggggcgcaagccggtgatcctgttc
ggtaccttgtcgttcgctttggccggggccgcctgcgccctggcgcagagtatcgatcaa
ttgatcgtgctgcgcctattgcacgggctggccgccgctgccgccagcgtagtgatcaac
gccctgatgcgcgatatgttcagcaaggatgagttctcgcgcatgatgtcgttcgtggtg
ctggtgatgaccatcgccccgttactggcaccgttgttgggcggggcgttgatgttatgg
tttagctggcatgctatcttctgggtgatggcggcggcggcactgtgcgcgacgctgctg
gtggcacgctttattcgagagacgctgccgcgcgagcggcgccaaccatttcgcctgtat
accacgctgactaattttgccacgctgtttcgccaccgtcgggtgttgagctacatgttg
gccggcgccttctccttttctggcatgttctccttctttagtgctggtccattcgtctat
atcgaactacacggcgtttcaccgcagcattttggctactactttgccctgaacatcctg
tttctgttcctcatgacgacctttaatggccgccatgtacgccggcgtggtgcccaaacg
atgctatgtttgggcctggcggtgcaattcatcatgggactttggctgttggcctgcgtc
tcgctggactggggtttttgggcactggttcttggcgtggcggcctatgttggctgtatc
gctatggtgtcatcgaatgctatggcggtgatcctggacagcttcccgcatatggccggt
acggctgcctcgttggccgggaccctgcgcttcggtctcagcgcgctggtcggcgcgttg
ttggcacagttgccgatcacctcggcgtggccgctggttgggtcgatggcattgtgcagc
accctcgcgatggcgctgtttctgtatgcggcgcgggcaccgacggcaggatga

DBGET integrated database retrieval system