KEGG   Edwardsiella hoshinae: A9798_05655Help
Entry
A9798_05655       CDS       T04508                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K00882  1-phosphofructokinase [EC:2.7.1.56]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00051  Fructose and mannose metabolism
eho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9798_05655
Enzymes [BR:eho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     A9798_05655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AOV96483
UniProt: A0A376DC10
LinkDB All DBs
Position
1269437..1270375
Genome map
AA seq 312 aa AA seqDB search
MSRRVATITLNPAYDLVGYCAEIERGEVNRVQTAGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQQLFSELGIANRFQVVPGRTRINVKLTEKDGAVTDFNFSGFDVSKSDWDR
FVNDSLSWLGQFDMVCVSGSLPAGVAADDFTDWMRRLRSQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRALPTLADVVGAAHALRDQGIAHVVISLGAEGALWVNASGAWLA
KPPAVEVISTVGAGDSMVGGLIYGLMMRESSEHTLRLATAVSALAVSQSNVGITDRTQLA
AMMARVELDPFN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaagagtagcaaccatcaccttaaacccggcttacgatctggttggctattgt
gccgagatcgagcgcggtgaagtcaaccgggtgcagaccgccgggctgcatgccgcgggt
aaggggatcaacgtcgctaaagtgctgaaggatctgggcatcgatgtgacagtaggcggt
tttctgggcaaggacaaccaagatggttttcagcagttgttcagcgagctggggatcgcc
aaccgctttcaagtcgtaccgggacgcacacgcatcaatgtgaagctgacggagaaagat
ggcgcggtcaccgactttaacttctccggtttcgacgtcagcaagagtgactgggatcgt
ttcgtcaatgattcgctcagttggttgggacagttcgatatggtgtgtgtcagcggcagt
ctaccggctggcgtggcggcggacgacttcaccgactggatgcgacgtctgcgcagtcag
tgcccgtgcatcatcttcgacagcagtcgcgaggcgttggtcgccggactgaaggcggca
ccgtggttggtgaagccgaatcgtcgcgagctggagatttgggcaggccgtgcgttgccg
accttggcggatgtggttggcgcggcgcatgcgctgcgtgaccaggggatcgcccatgtg
gtgatttcgctcggcgccgaaggtgcgctgtgggtcaacgcctctggcgcctggctggcg
aagccgccggcggttgaggttatcagtactgtcggtgccggtgactcgatggtgggcggg
ctgatttatggcctgatgatgcgcgaatccagcgaacataccctacgactggccacggca
gtgtctgccttggcggttagccagagcaatgttggcattaccgatcggactcaacttgcc
gcgatgatggcgcgcgtggagctcgatccttttaactga

DBGET integrated database retrieval system