KEGG   Edwardsiella hoshinae: A9798_08020Help
Entry
A9798_08020       CDS       T04508                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eho  Edwardsiella hoshinae
Brite
Enzymes [BR:eho01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A9798_08020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOV96909
UniProt: A0A1D8MY32
LinkDB All DBs
Position
complement(1820957..1821535)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAKNALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTEFEGKSLEAIIKTA
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGALAEAINAAFGSFAAFQEALTKSAIANFG
SGWTWLVKKADGSLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWEFVAQNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattacctgcattaccgtacgccaagaatgcgctggagccgcatatctcc
gcggaaaccctggagtaccattacggtaagcaccacaacacctatgtggttaacctgaac
aacctgatcaagggcaccgaattcgaaggcaaatcgctggaagcgatcatcaaaaccgcc
agcggcgggatcttcaacaacgccgctcaggtatggaaccacaccttctattggcattgc
ctctctccgaacggcggcggcgagccgaccggcgcgctggccgaggcgatcaatgctgct
ttcggctccttcgccgctttccaggaagcgctgaccaagtcggctatcgccaacttcggc
tccggctggacctggctggtgaagaaagcggacggtagcctagccatcgtcaatacctct
aacgcagcaaccccgctgactggcgacgataagccgctgctgaccgtcgacgtctgggag
cacgcctattacatcgactaccgcaacgcgcgtccgaaatacctggaaaacttctgggca
ctggttaactgggagttcgtagcccagaatctggcctga

DBGET integrated database retrieval system