KEGG   Edwardsiella hoshinae: A9798_08085
Entry
A9798_08085       CDS       T04508                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00480  Glutathione metabolism
eho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A9798_08085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eho02000]
    A9798_08085
Enzymes [BR:eho01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A9798_08085
Transporters [BR:eho02000]
 Other transporters
  Pores ion channels [TC:1]
   A9798_08085
SSDB
Motif
Pfam: GST_N GST_N_2 GST_C GST_N_3 GST_C_3 GST_C_2 GST_C_6 GST_N_5
Other DBs
NCBI-ProteinID: AOV96921
UniProt: A0A376DER8
LinkDB
Position
complement(1833319..1833924)
AA seq 201 aa
MKLFYKSGACSLSPHIVLREAGLDFTIESVDLANKRTEHGGDYLRINPKGQVPALLLDDG
TVLTEGVAIVQYLADRVPDRKLIPPAESLARYHAIEWLNYIATELHKGFSPLFNPRLSEE
NKAAARAGLEKQFRYLDTTLGERPYLLGQDFSVADAYLFTILCWAKAMHFDLNQWPTLAA
YMARIAARPAVVATLNAEGLA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaagttattctataaatcaggggcctgttcactctcgccacatatcgtactgcgcgag
gctgggctagacttcaccatcgaaagcgtcgatctggccaataagcgtaccgagcatggc
ggagactatctgcgcatcaaccccaaaggacaagtgccggcattgctgctggatgatggc
accgtgttaaccgagggggtcgccatcgtgcagtatctcgccgatcgtgtgccggatcga
aagctgatcccgcctgccgagagtctggcgcgttatcacgccatcgaatggctcaactat
atcgccaccgaactccacaagggattcagcccgttattcaatccccgtctgtcagaggaa
aacaaggcggcggctcgagccggactggagaaacagtttcgctacctcgatacgaccctc
ggcgaacgcccctacctgctcggtcaggactttagcgtcgccgatgcctacctgttcacc
atcctctgttgggccaaggcgatgcatttcgatctgaaccaatggccgacgttggcggcc
tatatggcgcgtatcgccgcccggccggcggtggtggcgacgctgaatgccgaaggattg
gcgtag

DBGET integrated database retrieval system